Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B)

Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CELA3B. Target Synonyms: Elastase IIIB (Elastase-3B; Protease E; ELA3B) . Accession Number: P08861. Expression Region: 29~270aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B) is a purified Recombinant Protein.

Accession Number

P08861

Expression Region

29~270aa

Host

E. coli

Target

CELA3B

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Elastase IIIB (Elastase-3B; Protease E; ELA3B)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

B230118H07Rik 3'UTR GFP Stable Cell Line
TU152449 1.0 mL

B230118H07Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human soluble Triggering Receptor Expresses on Myeloid Cells-1 (sTREM-1) ELISA Kit
QY-E02460 96 Tests

Human soluble Triggering Receptor Expresses on Myeloid Cells-1 (sTREM-1) ELISA Kit

Sign In for Pricing
View Details
Xpress™ Human PAPD5 Over-expressing Stable Cell Line
ABC-X2215 1 Vial

Xpress™ Human PAPD5 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
GALNT13 (KIAA1918, Polypeptide N-acetylgalactosaminyltransferase 13, Polypeptide GalNAc Transferase 13, Protein-UDP Acetylgalactosaminyltransferase 13, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13, FLJ16031, FLJ41157, H_NH0187G20.1, MGC119459, MGC119461) (MaxLight 750) discontinued
127133-ML750 100 µL

GALNT13 (KIAA1918, Polypeptide N-acetylgalactosaminyltransferase 13, Polypeptide GalNAc Transferase 13, Protein-UDP Acetylgalactosaminyltransferase 13, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13, FLJ16031, FLJ41157, H_NH0187G20.1, MGC119459, MGC119461) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Titrant Ammonia 2M in 1-Propanol - 5L
NH1P22005 5 L

Titrant Ammonia 2M in 1-Propanol - 5L

Sign In for Pricing
View Details
Collagen II Mouse Monoclonal Antibody(9C5)
MBS9417672-01 0.05 mL

Collagen II Mouse Monoclonal Antibody(9C5)

Sign In for Pricing
View Details