Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B)

Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CELA3B. Target Synonyms: Elastase IIIB (Elastase-3B; Protease E; ELA3B) . Accession Number: P08861. Expression Region: 29~270aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B) is a purified Recombinant Protein.

Accession Number

P08861

Expression Region

29~270aa

Host

E. coli

Target

CELA3B

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Elastase IIIB (Elastase-3B; Protease E; ELA3B)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti RSV
MBS315201-01 1 mL

Goat anti RSV

Sign In for Pricing
View Details
Goat anti RSV
MBS315201-02 5x 1 mL

Goat anti RSV

Sign In for Pricing
View Details
Recombinant Human Toll Like Receptor 5 (TLR5)
RPU44078-01 50 µg

Recombinant Human Toll Like Receptor 5 (TLR5)

Sign In for Pricing
View Details
Recombinant Human Toll Like Receptor 5 (TLR5)
RPU44078-02 100 µg

Recombinant Human Toll Like Receptor 5 (TLR5)

Sign In for Pricing
View Details
Recombinant Human Toll Like Receptor 5 (TLR5)
RPU44078-03 1 mg

Recombinant Human Toll Like Receptor 5 (TLR5)

Sign In for Pricing
View Details
Rabbit Polyclonal PGAM1 Antibody [Alexa Fluor 647]
NBP1-49532AF647 0.1 mL

Rabbit Polyclonal PGAM1 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details