Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B)

Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CELA3B. Target Synonyms: Elastase IIIB (Elastase-3B; Protease E; ELA3B) . Accession Number: P08861. Expression Region: 29~270aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B) is a purified Recombinant Protein.

Accession Number

P08861

Expression Region

29~270aa

Host

E. coli

Target

CELA3B

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Elastase IIIB (Elastase-3B; Protease E; ELA3B)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHC (Phospho Tyr427) (11R16) Rabbit Monoclonal Antibody
E28G2419 100 µL

SHC (Phospho Tyr427) (11R16) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human SMAC/DIABLO Protein, Untagged, E.coli-5ug
QP13525-5ug 5ug

Recombinant Human SMAC/DIABLO Protein, Untagged, E.coli-5ug

Sign In for Pricing
View Details
Rabbit Anti-AVP Receptor V3/AVPR1B Polyclonal Antibody
PAV5164 100 μL

Rabbit Anti-AVP Receptor V3/AVPR1B Polyclonal Antibody

Sign In for Pricing
View Details
Goat Polyclonal DYKDDDDK Epitope Tag Antibody [Alexa Fluor 700]
NB600-344AF700 0.1 mL

Goat Polyclonal DYKDDDDK Epitope Tag Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Thiobenzoic acid
sc-251232 100 g

Thiobenzoic acid

Sign In for Pricing
View Details
CCDC51 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV708410 1.0 µg DNA

CCDC51 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details