Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B)

Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CELA3B. Target Synonyms: Elastase IIIB (Elastase-3B; Protease E; ELA3B) . Accession Number: P08861. Expression Region: 29~270aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B) is a purified Recombinant Protein.

Accession Number

P08861

Expression Region

29~270aa

Host

E. coli

Target

CELA3B

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Elastase IIIB (Elastase-3B; Protease E; ELA3B)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBLN1 siRNA (Human)
MBS8220616-01 15 nmol

FBLN1 siRNA (Human)

Sign In for Pricing
View Details
FBLN1 siRNA (Human)
MBS8220616-02 30 nmol

FBLN1 siRNA (Human)

Sign In for Pricing
View Details
FBLN1 siRNA (Human)
MBS8220616-03 5x 30 nmol

FBLN1 siRNA (Human)

Sign In for Pricing
View Details
Neuropeptide FF1 Receptor (Neuropeptide FF Receptor 1, NPFFR1, NPFF1R1, NPFF1, FLJ10751, G-protein Coupled Receptor 147, GPR147, RFamide-related Peptide Receptor OT7T022) (Not for Export EU)
N2176-09E 100 µL

Neuropeptide FF1 Receptor (Neuropeptide FF Receptor 1, NPFFR1, NPFF1R1, NPFF1, FLJ10751, G-protein Coupled Receptor 147, GPR147, RFamide-related Peptide Receptor OT7T022) (Not for Export EU)

Sign In for Pricing
View Details
MagaBio plus Maxi Whole Blood Genomic DNA Purification Kit
TRI-C90T1S 16T

MagaBio plus Maxi Whole Blood Genomic DNA Purification Kit

Sign In for Pricing
View Details
Mouse Monoclonal GSTA4 Antibody (OTI3F5) [Alexa Fluor 700]
NBP2-70856AF700 0.1 mL

Mouse Monoclonal GSTA4 Antibody (OTI3F5) [Alexa Fluor 700]

Sign In for Pricing
View Details