Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B)

Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CELA3B. Target Synonyms: Elastase IIIB (Elastase-3B; Protease E; ELA3B) . Accession Number: P08861. Expression Region: 29~270aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B) is a purified Recombinant Protein.

Accession Number

P08861

Expression Region

29~270aa

Host

E. coli

Target

CELA3B

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Elastase IIIB (Elastase-3B; Protease E; ELA3B)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli ST-B Protein (aa 1-18)
VAng-Lsx02644-500gEcoli 500 µg (E. coli)

Recombinant Escherichia coli ST-B Protein (aa 1-18)

Sign In for Pricing
View Details
Ccdc162 (NM_001177571) Mouse Tagged ORF Clone
MG225962 10 µg

Ccdc162 (NM_001177571) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ZPLD1 sgRNA CRISPR Lentivector (Human) (Target 3)
K2740504 1.0 µg DNA

ZPLD1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Guinea pig Epidermal Fatty Acid Binding Protein (eFABP) ELISA Kit
EIA06629Gu 1 Kit

Guinea pig Epidermal Fatty Acid Binding Protein (eFABP) ELISA Kit

Sign In for Pricing
View Details
KCTD12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1127605 3x 1.0 µg

KCTD12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
STMN1 Protein Vector (Human) (pPM-C-HA)
PV040603 500 ng

STMN1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details