Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat D-dopachrome decarboxylase (Ddt)

Recombinant Rat D-dopachrome decarboxylase (Ddt) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Ddt. Target Synonyms: D-dopachrome tautomerase. Accession Number: P80254. Expression Region: 2~118aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 20.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat D-dopachrome decarboxylase (Ddt) is a purified Recombinant Protein.

Accession Number

P80254

Expression Region

2~118aa

Host

E. coli

Target

Ddt

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

D-dopachrome tautomerase

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLISSIGVVGTAEQNRSHSSSFFKFLTEELSLDQDRIIIRFFPLEPWQIGKKGTVMTFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Glycine amidinotransferase, mitochondrial, Gatm ELISA KIT
ELI-09678m 96 Tests

Mouse Glycine amidinotransferase, mitochondrial, Gatm ELISA KIT

Sign In for Pricing
View Details
Ubxn2b ORF Vector (Rat) (pORF)
49065016 1.0 µg DNA

Ubxn2b ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Zinc Finger And BTB Domain-Containing Protein 22 (ZBTB22) Antibody
abx239590 100 µg

Zinc Finger And BTB Domain-Containing Protein 22 (ZBTB22) Antibody

Sign In for Pricing
View Details
N- (tert-Butoxycarbonyl) -L-phenylalanine acid hydrazide
sc-263756A 5 g

N- (tert-Butoxycarbonyl) -L-phenylalanine acid hydrazide

Sign In for Pricing
View Details
PE Anti-human CD164 Antibody *67D2*
116401K2-AAT 500 Tests

PE Anti-human CD164 Antibody *67D2*

Sign In for Pricing
View Details
LIME (LIME1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D3]
TA807703AM 100 µL

LIME (LIME1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D3]

Sign In for Pricing
View Details