Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat D-dopachrome decarboxylase (Ddt)

Recombinant Rat D-dopachrome decarboxylase (Ddt) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Ddt. Target Synonyms: D-dopachrome tautomerase. Accession Number: P80254. Expression Region: 2~118aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 20.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat D-dopachrome decarboxylase (Ddt) is a purified Recombinant Protein.

Accession Number

P80254

Expression Region

2~118aa

Host

E. coli

Target

Ddt

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

D-dopachrome tautomerase

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLISSIGVVGTAEQNRSHSSSFFKFLTEELSLDQDRIIIRFFPLEPWQIGKKGTVMTFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRPEL1, ID (GRPEL1, GREPEL1, GrpE protein homolog 1, mitochondrial, HMGE, Mt-GrpE#1) (Azide free) (HRP)
MBS6304529-01 0.2 mL

GRPEL1, ID (GRPEL1, GREPEL1, GrpE protein homolog 1, mitochondrial, HMGE, Mt-GrpE#1) (Azide free) (HRP)

Sign In for Pricing
View Details
GRPEL1, ID (GRPEL1, GREPEL1, GrpE protein homolog 1, mitochondrial, HMGE, Mt-GrpE#1) (Azide free) (HRP)
MBS6304529-02 5x 0.2 mL

GRPEL1, ID (GRPEL1, GREPEL1, GrpE protein homolog 1, mitochondrial, HMGE, Mt-GrpE#1) (Azide free) (HRP)

Sign In for Pricing
View Details
TNP2 Protein Lysate (Mouse) with C-HA Tag
47254034 100 µg

TNP2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
STAM2 (Signal Transducing Adapter Molecule 2)
492980 100 µL

STAM2 (Signal Transducing Adapter Molecule 2)

Sign In for Pricing
View Details
Collagen alpha-1 (X) chain
AP82036 1 mg

Collagen alpha-1 (X) chain

Sign In for Pricing
View Details
RAB28 Peptide - middle region
MBS3248477-01 0.1 mg

RAB28 Peptide - middle region

Sign In for Pricing
View Details