Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat D-dopachrome decarboxylase (Ddt)

Recombinant Rat D-dopachrome decarboxylase (Ddt) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Ddt. Target Synonyms: D-dopachrome tautomerase. Accession Number: P80254. Expression Region: 2~118aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 20.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat D-dopachrome decarboxylase (Ddt) is a purified Recombinant Protein.

Accession Number

P80254

Expression Region

2~118aa

Host

E. coli

Target

Ddt

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

D-dopachrome tautomerase

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLISSIGVVGTAEQNRSHSSSFFKFLTEELSLDQDRIIIRFFPLEPWQIGKKGTVMTFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCL28 activation kit by CRISPRa
GA111190 1 Kit

Human CCL28 activation kit by CRISPRa

Sign In for Pricing
View Details
USP29 3'UTR Luciferase Stable Cell Line
TU027995 1.0 mL

USP29 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit anti Cyclin A Polyclonal Antibody
MBS460273-01 0.1 mg

Rabbit anti Cyclin A Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Cyclin A Polyclonal Antibody
MBS460273-02 5x 0.1 mg

Rabbit anti Cyclin A Polyclonal Antibody

Sign In for Pricing
View Details
4-Hydroxy-3-methoxybenzyl alcohol (Vanillyl alcohol)
63880340 100 g

4-Hydroxy-3-methoxybenzyl alcohol (Vanillyl alcohol)

Sign In for Pricing
View Details
Thalidomide-O-amido-PEG3-C2-NH2 500mg
A20161-500 500 mg

Thalidomide-O-amido-PEG3-C2-NH2 500mg

Sign In for Pricing
View Details