Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Osteocalcin (BGLAP)

Recombinant Dog Osteocalcin (BGLAP) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Dog (Canis familiaris; Canine) . Target Name: BGLAP. Target Synonyms: Bone Gla protein (BGP; Gamma-carboxyglutamic acid-containing protein) . Accession Number: P81455. Expression Region: 1~49aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 20.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Dog Osteocalcin (BGLAP) is a purified Recombinant Protein.

Accession Number

P81455

Expression Region

1~49aa

Host

E. coli

Target

BGLAP

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Ksi-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Bone Gla protein (BGP; Gamma-carboxyglutamic acid-containing protein)

Species

Dog (Canis familiaris; Canine)

Protein Name

Recombinant Protein

AA Sequence

YLDSGLGAPVPYPDPLEPKREVCELNPNCDELADHIGFQEAYQRFYGPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HFM1 Polyclonal Antibody, PE Conjugated
bs-15471R-PE 100 µL

HFM1 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Trim39 (BC031540) Mouse Recombinant Protein
E45M46019M5 20 µg

Trim39 (BC031540) Mouse Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse IL-23A Protein (Fc Tag)
PDMM100097-01 20 µg

Recombinant Mouse IL-23A Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-23A Protein (Fc Tag)
PDMM100097-02 100 µg

Recombinant Mouse IL-23A Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-23A Protein (Fc Tag)
PDMM100097-03 500 µg

Recombinant Mouse IL-23A Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-23A Protein (Fc Tag)
PDMM100097-04 1 mg

Recombinant Mouse IL-23A Protein (Fc Tag)

Sign In for Pricing
View Details