Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Osteocalcin (BGLAP)

Recombinant Dog Osteocalcin (BGLAP) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Dog (Canis familiaris; Canine) . Target Name: BGLAP. Target Synonyms: Bone Gla protein (BGP; Gamma-carboxyglutamic acid-containing protein) . Accession Number: P81455. Expression Region: 1~49aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 20.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Dog Osteocalcin (BGLAP) is a purified Recombinant Protein.

Accession Number

P81455

Expression Region

1~49aa

Host

E. coli

Target

BGLAP

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Ksi-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Bone Gla protein (BGP; Gamma-carboxyglutamic acid-containing protein)

Species

Dog (Canis familiaris; Canine)

Protein Name

Recombinant Protein

AA Sequence

YLDSGLGAPVPYPDPLEPKREVCELNPNCDELADHIGFQEAYQRFYGPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elk1 (NM_001108059) Rat Tagged ORF Clone
RR212867 10 µg

Elk1 (NM_001108059) Rat Tagged ORF Clone

Sign In for Pricing
View Details
IRAK1BP1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
25072154 3x 1.0 µg DNA

IRAK1BP1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA, CD66e) (MaxLight 550) discontinued
C1299-94-ML550 100 µL

Carcinoembryonic Antigen (CEA, CD66e) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Lumican Protein, Human, Recombinant (His Tag)
MBS8120894-01 0.1 mg

Lumican Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Lumican Protein, Human, Recombinant (His Tag)
MBS8120894-02 5x 0.1 mg

Lumican Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Lentiviral human ANKRD7 shRNA (UAS) - Lentiviral human ANKRD7 shRNA (UAS) (25)
GTR15330752 1 Vial

Lentiviral human ANKRD7 shRNA (UAS) - Lentiviral human ANKRD7 shRNA (UAS) (25)

Sign In for Pricing
View Details