Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Osteocalcin (BGLAP)

Recombinant Dog Osteocalcin (BGLAP) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Dog (Canis familiaris; Canine) . Target Name: BGLAP. Target Synonyms: Bone Gla protein (BGP; Gamma-carboxyglutamic acid-containing protein) . Accession Number: P81455. Expression Region: 1~49aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 20.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Dog Osteocalcin (BGLAP) is a purified Recombinant Protein.

Accession Number

P81455

Expression Region

1~49aa

Host

E. coli

Target

BGLAP

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Ksi-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Bone Gla protein (BGP; Gamma-carboxyglutamic acid-containing protein)

Species

Dog (Canis familiaris; Canine)

Protein Name

Recombinant Protein

AA Sequence

YLDSGLGAPVPYPDPLEPKREVCELNPNCDELADHIGFQEAYQRFYGPV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Platelet Glycoprotein 4 (CD36) Antibody
abx339894-01 50 µL

Platelet Glycoprotein 4 (CD36) Antibody

Sign In for Pricing
View Details
Platelet Glycoprotein 4 (CD36) Antibody
abx339894-02 100 µL

Platelet Glycoprotein 4 (CD36) Antibody

Sign In for Pricing
View Details
JAZF1-SUZ12 Dual Fusion - Translocation FISH Probe
FON-273 10 Tests

JAZF1-SUZ12 Dual Fusion - Translocation FISH Probe

Sign In for Pricing
View Details
AP2A1 sgRNA CRISPR Lentivector set (Human)
K0100401 3x 1.0 µg

AP2A1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Anti-O2T29/OR2T29 Polyclonal Antibody
PAV2677 100 μL

Rabbit Anti-O2T29/OR2T29 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human MAP2K6 Protein, N-His
YHE92201 100 μg

Recombinant Human MAP2K6 Protein, N-His

Sign In for Pricing
View Details