Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 13A1 (OR13A1)

Recombinant Human Olfactory receptor 13A1 (OR13A1) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: OR13A1. Target Synonyms: Olfactory receptor OR10-3. Accession Number: Q8NGR1. Expression Region: 1~328aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 39.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Olfactory receptor 13A1 (OR13A1) is a purified CF Transmembrane Protein.

Accession Number

Q8NGR1

Expression Region

1~328aa

Host

E. coli

Target

OR13A1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Olfactory receptor OR10-3

Species

Human (Homo sapiens)

Protein Name

CF Transmembrane Protein

AA Sequence

MKLWMESHLIVPETRPSPRMMSNQTLVTEFILQGFSEHPEYRVFLFSCFLFLYSGALTGNVLITLAITFNPGLHAPMYFFLLNLATMDIICTSSIMPKALASLVSEESSISYGGCMAQLYFLTWAASSELLLLTVMAYDRYAAICHPLHYSSMMSKVFCSGLATAVWLLCAVNTAIHTGLMLRLDFCGPNVIIHFFCEVPPLLLLSCSSTYVNGVMIVLADAFYGIVNFLMTIASYGFIVSSILKVKTAWGRQKAFSTCSSHLTVVCMYYTAVFYAYISPVSGYSAGKSKLAGLLYTVLSPTLNPLIYTLRNKEVKAALRKLFPFFRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem217 (NM_001162902) Mouse Tagged ORF Clone Lentiviral Particle
MR214996L4V 200 µL

Tmem217 (NM_001162902) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Insulin Like Growth Factor Binding Protein 7 (IGFBP7) Recombinant, Rat
155207-01 10 µg

Insulin Like Growth Factor Binding Protein 7 (IGFBP7) Recombinant, Rat

Sign In for Pricing
View Details
Insulin Like Growth Factor Binding Protein 7 (IGFBP7) Recombinant, Rat
155207-02 50 µg

Insulin Like Growth Factor Binding Protein 7 (IGFBP7) Recombinant, Rat

Sign In for Pricing
View Details
Insulin Like Growth Factor Binding Protein 7 (IGFBP7) Recombinant, Rat
155207-03 200 µg

Insulin Like Growth Factor Binding Protein 7 (IGFBP7) Recombinant, Rat

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Cell death abnormality protein 8 (ced-8), partial
MBS1084823-01 1 mg (E-Coli)

Recombinant Caenorhabditis elegans Cell death abnormality protein 8 (ced-8), partial

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Cell death abnormality protein 8 (ced-8), partial
MBS1084823-02 1 mg (Yeast)

Recombinant Caenorhabditis elegans Cell death abnormality protein 8 (ced-8), partial

Sign In for Pricing
View Details