Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 13A1 (OR13A1)

Recombinant Human Olfactory receptor 13A1 (OR13A1) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: OR13A1. Target Synonyms: Olfactory receptor OR10-3. Accession Number: Q8NGR1. Expression Region: 1~328aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 39.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Olfactory receptor 13A1 (OR13A1) is a purified CF Transmembrane Protein.

Accession Number

Q8NGR1

Expression Region

1~328aa

Host

E. coli

Target

OR13A1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Olfactory receptor OR10-3

Species

Human (Homo sapiens)

Protein Name

CF Transmembrane Protein

AA Sequence

MKLWMESHLIVPETRPSPRMMSNQTLVTEFILQGFSEHPEYRVFLFSCFLFLYSGALTGNVLITLAITFNPGLHAPMYFFLLNLATMDIICTSSIMPKALASLVSEESSISYGGCMAQLYFLTWAASSELLLLTVMAYDRYAAICHPLHYSSMMSKVFCSGLATAVWLLCAVNTAIHTGLMLRLDFCGPNVIIHFFCEVPPLLLLSCSSTYVNGVMIVLADAFYGIVNFLMTIASYGFIVSSILKVKTAWGRQKAFSTCSSHLTVVCMYYTAVFYAYISPVSGYSAGKSKLAGLLYTVLSPTLNPLIYTLRNKEVKAALRKLFPFFRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR16 Polyclonal Antibody, RBITC Conjugated
bs-6750R-RBITC-TR 20 µL

WDR16 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
HIP1 (C) Antibody, Rabbit Polyclonal
orb386989 100 µL

HIP1 (C) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Snapc2 ORF Vector (Mouse) (pORF)
44506014 1.0 µg DNA

Snapc2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
RN5S282 Protein Vector (Human) (pPM-C-His)
PV116729 500 ng

RN5S282 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human Chondroitin Polymerizing Factor (CHPF) ELISA Kit
abx386512 96 Tests

Human Chondroitin Polymerizing Factor (CHPF) ELISA Kit

Sign In for Pricing
View Details
EHMT2 Antibody, mAb, Rabbit
A05179-100 100 µL

EHMT2 Antibody, mAb, Rabbit

Sign In for Pricing
View Details