Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TLC domain-containing protein 1 (TLCD1)

Recombinant Human TLC domain-containing protein 1 (TLCD1) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TLCD1. Target Synonyms: TLC domain-containing protein 1 (Calfacilitin) . Accession Number: Q96CP7. Expression Region: 36~247aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 26.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human TLC domain-containing protein 1 (TLCD1) is a purified CF Transmembrane Protein.

Accession Number

Q96CP7

Expression Region

36~247aa

Host

E. coli

Target

TLCD1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TLC domain-containing protein 1 (Calfacilitin)

Species

Human (Homo sapiens)

Protein Name

CF Transmembrane Protein

AA Sequence

RADPLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFLFRLAPQAYLTHFFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFLTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tyrp1 shRNA (UAS) - Lentiviral mouse Tyrp1 shRNA (UAS, RFP) plasmid
GTR15164173 1 Vial

Lentiviral mouse Tyrp1 shRNA (UAS) - Lentiviral mouse Tyrp1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
GSK3 Alpha + Beta Rabbit pAb, PE-Cy5.5 conjugated
orb2886941 100 µL

GSK3 Alpha + Beta Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Caveolin 1 (CAV1) Human Gene Knockout Kit (CRISPR)
KN410274 1 Kit

Caveolin 1 (CAV1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BCL2L10 Antibody Blocking Peptide
orb1503325 500 µg

BCL2L10 Antibody Blocking Peptide

Sign In for Pricing
View Details
Anti-Cortactin (4F11-G5-F10) Recombinant Chicken Chimeric mAb FL594 Conjugate
78-601-FL594 200 µL

Anti-Cortactin (4F11-G5-F10) Recombinant Chicken Chimeric mAb FL594 Conjugate

Sign In for Pricing
View Details
Rabbit Polyclonal DHRS4 Antibody
NBP1-83790 0.1 mL

Rabbit Polyclonal DHRS4 Antibody

Sign In for Pricing
View Details