Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TLC domain-containing protein 1 (TLCD1)

Recombinant Human TLC domain-containing protein 1 (TLCD1) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TLCD1. Target Synonyms: TLC domain-containing protein 1 (Calfacilitin) . Accession Number: Q96CP7. Expression Region: 36~247aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 26.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human TLC domain-containing protein 1 (TLCD1) is a purified CF Transmembrane Protein.

Accession Number

Q96CP7

Expression Region

36~247aa

Host

E. coli

Target

TLCD1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TLC domain-containing protein 1 (Calfacilitin)

Species

Human (Homo sapiens)

Protein Name

CF Transmembrane Protein

AA Sequence

RADPLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFLFRLAPQAYLTHFFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFLTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2T (D2L7H) Rabbit Monoclonal Antibody
CST 12992S 100 µL

UBE2T (D2L7H) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human TNF beta
DC181-01 50 µg

Recombinant Human TNF beta

Sign In for Pricing
View Details
Recombinant Human TNF beta
DC181-02 500 µg

Recombinant Human TNF beta

Sign In for Pricing
View Details
Recombinant Human TNF beta
DC181-03 1 mg

Recombinant Human TNF beta

Sign In for Pricing
View Details
Human Perforin 1 Pore-Forming Protein CLIA Kit
MBS8425848-01 1 Kit

Human Perforin 1 Pore-Forming Protein CLIA Kit

Sign In for Pricing
View Details
Human Perforin 1 Pore-Forming Protein CLIA Kit
MBS8425848-02 5x 1 Kit

Human Perforin 1 Pore-Forming Protein CLIA Kit

Sign In for Pricing
View Details