Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus NL63 Membrane protein (M)

Recombinant Human coronavirus NL63 Membrane protein (M) is a purified CF Transmembrane Protein; Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human coronavirus NL63 (HCoV-NL63) . Target Name: M. Target Synonyms: E1 glycoproteinMatrix glycoproteinMembrane glycoprotein. Accession Number: Q6Q1R9. Expression Region: 1~226aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 28.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human coronavirus NL63 Membrane protein (M) is a purified CF Transmembrane Protein; Coronavirus Protein.

Accession Number

Q6Q1R9

Expression Region

1~226aa

Host

E. coli

Target

M

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

E1 glycoproteinMatrix glycoproteinMembrane glycoprotein

Species

Human coronavirus NL63 (HCoV-NL63)

Protein Name

CF Transmembrane Protein; Coronavirus Protein

AA Sequence

MSNSSVPLLEVYVHLRNWNFSWNLILTLFIVVLQYGHYKYSRLLYGLKMSVLWCLWPLVLALSIFDCFVNFNVDWVFFGFSILMSIITLCLWVMYFVNSFRLWRRVKTFWAFNPETNAIISLQVYGHNYYLPVMAAPTGVTLTLLSGVLLVDGHKIATRVQVGQLPKYVIVATPSTTIVCDRVGRSVNETSQTGWAFYVRAKHGDFSGVASQEGVLSEREKLLHLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arl5b sgRNA CRISPR Lentivector set (Mouse)
K4466801 3x 1.0 µg

Arl5b sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
KDM2B Protein Vector (Mouse) (pPM-C-HA)
PV194032 500 ng

KDM2B Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 7 Na (+)/H (+) antiporter nhaB, partial
MBS1244446-01 1 mg (E-Coli)

Recombinant Actinobacillus pleuropneumoniae serotype 7 Na (+)/H (+) antiporter nhaB, partial

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 7 Na (+)/H (+) antiporter nhaB, partial
MBS1244446-02 1 mg (Yeast)

Recombinant Actinobacillus pleuropneumoniae serotype 7 Na (+)/H (+) antiporter nhaB, partial

Sign In for Pricing
View Details
Rabbit Polyclonal to Human CHRM2 / M2
MBS247578-01 0.05 mg

Rabbit Polyclonal to Human CHRM2 / M2

Sign In for Pricing
View Details
Rabbit Polyclonal to Human CHRM2 / M2
MBS247578-02 5x 0.05 mg

Rabbit Polyclonal to Human CHRM2 / M2

Sign In for Pricing
View Details