Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5AL1 (OR5AL1)

Recombinant Human Olfactory receptor 5AL1 (OR5AL1) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: OR5AL1. Target Synonyms: Olfactory receptor OR11-184. Accession Number: P0C617. Expression Region: 1~328aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 39.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Olfactory receptor 5AL1 (OR5AL1) is a purified CF Transmembrane Protein.

Accession Number

P0C617

Expression Region

1~328aa

Host

E. coli

Target

OR5AL1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Olfactory receptor OR11-184

Species

Human (Homo sapiens)

Protein Name

CF Transmembrane Protein

AA Sequence

MCALKGFLEENFYTYSVAKGNHSTVYEFILLGLTDNAELQVTLFGIFLVVYLASFMGNFGLIMLIQISPQLHTPMYFFLSHLAFVDFSFTSSVAPNTLVNFLCEVKSITFYACAIQVCCFITFVVCELYLLSIMAYDRYVAICNPLLYVILIPRKCIKLIASTYVYGFTVGLVQTVATSYLSFCDSNVINHFYHDDVPLVALACSDTHVKELMLLIIAGFNTLCSLVIVLISYGFIFFAILRIHSAEGRQKAFSTSASHLTSITIFYGTIIFMYPQPKSSHSLNMDKVASVFNVVVIPTLNPLIYSLRNQEVKNALKRIIEKLCLAVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-OSBPL5 Antibody Picoband® Fluoro647 Conjugated
A07477-1-Fluoro647 100 µg/Vial

Anti-OSBPL5 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
GPR1 siRNA (m)
sc-60724 10 µM

GPR1 siRNA (m)

Sign In for Pricing
View Details
Goat Calcium homeostasis modulator protein 1 (CALHM1) ELISA kit
GTR10474255 96 Well

Goat Calcium homeostasis modulator protein 1 (CALHM1) ELISA kit

Sign In for Pricing
View Details
Recombinant Human ZNF284 Protein
E30P12209 20 µg

Recombinant Human ZNF284 Protein

Sign In for Pricing
View Details
Anti-PDIA5 Antibody Picoband® Fluoro647 Conjugated
A09898-Fluoro647 100 µg/Vial

Anti-PDIA5 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
KRT1 Protein Lysate (Rat) with C-HA Tag
25923036 100 µg

KRT1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details