Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5AL1 (OR5AL1)

Recombinant Human Olfactory receptor 5AL1 (OR5AL1) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: OR5AL1. Target Synonyms: Olfactory receptor OR11-184. Accession Number: P0C617. Expression Region: 1~328aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 39.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Olfactory receptor 5AL1 (OR5AL1) is a purified CF Transmembrane Protein.

Accession Number

P0C617

Expression Region

1~328aa

Host

E. coli

Target

OR5AL1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Olfactory receptor OR11-184

Species

Human (Homo sapiens)

Protein Name

CF Transmembrane Protein

AA Sequence

MCALKGFLEENFYTYSVAKGNHSTVYEFILLGLTDNAELQVTLFGIFLVVYLASFMGNFGLIMLIQISPQLHTPMYFFLSHLAFVDFSFTSSVAPNTLVNFLCEVKSITFYACAIQVCCFITFVVCELYLLSIMAYDRYVAICNPLLYVILIPRKCIKLIASTYVYGFTVGLVQTVATSYLSFCDSNVINHFYHDDVPLVALACSDTHVKELMLLIIAGFNTLCSLVIVLISYGFIFFAILRIHSAEGRQKAFSTSASHLTSITIFYGTIIFMYPQPKSSHSLNMDKVASVFNVVVIPTLNPLIYSLRNQEVKNALKRIIEKLCLAVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRIT1 (NM_194454) Human Tagged Lenti ORF Clone
RC224624L3 10 µg

KRIT1 (NM_194454) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZFYVE19 Protein Vector (Mouse) (pPM-C-HA)
51228025 500 ng

ZFYVE19 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Orai3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4608008 1.0 µg DNA

Orai3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
DC Current Meter EDM-80
1091480/12 1 Each

DC Current Meter EDM-80

Sign In for Pricing
View Details
RPL21P69 sgRNA CRISPR Lentivector (Human) (Target 1)
K1929402 1.0 µg DNA

RPL21P69 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Disease resistance protein RPS5 (RPS5) , partial
MBS1119316 Inquire

Recombinant Arabidopsis thaliana Disease resistance protein RPS5 (RPS5) , partial

Sign In for Pricing
View Details