Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adenosine receptor A1 (ADORA1)

Recombinant Human Adenosine receptor A1 (ADORA1) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ADORA1. Accession Number: P30542. Expression Region: 1~326aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 39.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Adenosine receptor A1 (ADORA1) is a purified CF Transmembrane Protein.

Accession Number

P30542

Expression Region

1~326aa

Host

E. coli

Target

ADORA1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

G-Protein Coupled Receptor, Receptor, Transducer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human (Homo sapiens)

Protein Name

CF Transmembrane Protein

AA Sequence

MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEBPD Recombinant Protein (Human)
RP051640 100 µg

CEBPD Recombinant Protein (Human)

Sign In for Pricing
View Details
Lentiviral human SLC5A4 shRNA (UAS) - Lentiviral human SLC5A4 shRNA (UAS, GFP) (25)
GTR15154568 1 Vial

Lentiviral human SLC5A4 shRNA (UAS) - Lentiviral human SLC5A4 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii DNA replication complex GINS protein PSF3 (PSF3)
MBS1461297-01 0.05 mg (E-Coli)

Recombinant Ashbya gossypii DNA replication complex GINS protein PSF3 (PSF3)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii DNA replication complex GINS protein PSF3 (PSF3)
MBS1461297-02 0.05 mg (Yeast)

Recombinant Ashbya gossypii DNA replication complex GINS protein PSF3 (PSF3)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii DNA replication complex GINS protein PSF3 (PSF3)
MBS1461297-03 0.2 mg (E-Coli)

Recombinant Ashbya gossypii DNA replication complex GINS protein PSF3 (PSF3)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii DNA replication complex GINS protein PSF3 (PSF3)
MBS1461297-04 0.5 mg (E-Coli)

Recombinant Ashbya gossypii DNA replication complex GINS protein PSF3 (PSF3)

Sign In for Pricing
View Details