Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Crotalus atrox Snake venom serine protease catroxase-2

Recombinant Crotalus atrox Snake venom serine protease catroxase-2 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Crotalus atrox (Western diamondback rattlesnake) . Target Name: Crotalus atrox Snake venom serine protease catroxase-2. Target Synonyms: Catroxase II; Kallikrein-like EI. Accession Number: Q8QHK2. Expression Region: 25~258aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 29.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Crotalus atrox Snake venom serine protease catroxase-2 is a purified Recombinant Protein.

Accession Number

Q8QHK2

Expression Region

25~258aa

Host

Baculovirus

Target

Crotalus atrox Snake venom serine protease catroxase-2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Catroxase II; Kallikrein-like EI

Species

Crotalus atrox (Western diamondback rattlesnake)

Protein Name

Recombinant Protein

AA Sequence

VVGGDECNINEHRSLVAIFNSTEFFCSGTLINQEWVVTAAHCDSTNFKMKLGVHSKKVPNEDEQTRNPKEKFFCPNKKKDDVLDKDIMLIKLDSPVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEKTLPDVPYCANIKLLDDAVCQPPYPELPATSRTLCAGIPEGGKDTCGGDSGGPLICNGQFQGIVFYGAHPCGQALKPGVYTKVFDYNDWIQSIIAGNTAATCPP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Erich2 (NM_025744) Mouse Tagged Lenti ORF Clone
MR214467L4 10 µg

Erich2 (NM_025744) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
1- (4,6-dimethylpyrimidin-2-yl) -6-oxo-1,4,5,6-tetrahydropyridazine-3-carboxylic acid
sc-333045 1 g

1- (4,6-dimethylpyrimidin-2-yl) -6-oxo-1,4,5,6-tetrahydropyridazine-3-carboxylic acid

Sign In for Pricing
View Details
L-15 With L-glutamine.
LVL02-500ML 500 mL

L-15 With L-glutamine.

Sign In for Pricing
View Details
RPL36AP6 AAV siRNA Pooled Vector
41583161 1.0 µg

RPL36AP6 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Silver Nitrate 1L 0.025N Dairy Testing - EACH
DAI1176 1 Each

Silver Nitrate 1L 0.025N Dairy Testing - EACH

Sign In for Pricing
View Details
CRIP2 (C-Term) Rabbit pAb
MBS8552668-01 0.1 mL

CRIP2 (C-Term) Rabbit pAb

Sign In for Pricing
View Details