Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Crotalus atrox Snake venom serine protease catroxase-2

Recombinant Crotalus atrox Snake venom serine protease catroxase-2 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Crotalus atrox (Western diamondback rattlesnake) . Target Name: Crotalus atrox Snake venom serine protease catroxase-2. Target Synonyms: Catroxase II; Kallikrein-like EI. Accession Number: Q8QHK2. Expression Region: 25~258aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 29.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Crotalus atrox Snake venom serine protease catroxase-2 is a purified Recombinant Protein.

Accession Number

Q8QHK2

Expression Region

25~258aa

Host

Baculovirus

Target

Crotalus atrox Snake venom serine protease catroxase-2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Catroxase II; Kallikrein-like EI

Species

Crotalus atrox (Western diamondback rattlesnake)

Protein Name

Recombinant Protein

AA Sequence

VVGGDECNINEHRSLVAIFNSTEFFCSGTLINQEWVVTAAHCDSTNFKMKLGVHSKKVPNEDEQTRNPKEKFFCPNKKKDDVLDKDIMLIKLDSPVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEKTLPDVPYCANIKLLDDAVCQPPYPELPATSRTLCAGIPEGGKDTCGGDSGGPLICNGQFQGIVFYGAHPCGQALKPGVYTKVFDYNDWIQSIIAGNTAATCPP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC27A6 Protein Lysate (Mouse) with C-HA Tag
44080034 100 µg

SLC27A6 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Anti-TCF21 Antibody (R1E27)
RHA74601 100 μg

Anti-TCF21 Antibody (R1E27)

Sign In for Pricing
View Details
CoCoA Overexpression Lysate (Native) - (Dry Ice)
NBL1-08645 0.1 mg

CoCoA Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
SRD5A2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-6700R-BF594 100 µL

SRD5A2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
SNAP25 Rabbit pAb
MBS8543348-01 0.1 mL

SNAP25 Rabbit pAb

Sign In for Pricing
View Details
SNAP25 Rabbit pAb
MBS8543348-02 0.1 mL (AF405L)

SNAP25 Rabbit pAb

Sign In for Pricing
View Details