Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus HKU3 Spike glycoprotein (S), partial

Recombinant Bat coronavirus HKU3 Spike glycoprotein (S), partial is a purified Recombinant Protein; Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3) . Target Name: S. Target Synonyms: S glycoprotein; E2; Peplomer protein. Accession Number: Q3LZX1. Expression Region: 310~514aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 24.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bat coronavirus HKU3 Spike glycoprotein (S), partial is a purified Recombinant Protein; Coronavirus Protein.

Accession Number

Q3LZX1

Expression Region

310~514aa

Host

Baculovirus

Target

S

Conjugation

Unconjugated

Tag

C-Terminal 6Xhis-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

S glycoprotein; E2; Peplomer protein

Species

Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3)

Protein Name

Recombinant Coronavirus Protein

AA Sequence

RVSPTQEVIRFPNITNRCPFDKVFNATRFPNVYAWERTKISDCVADYTVLYNSTSFSTFKCYGVSPSKLIDLCFTSVYADTFLIRSSEVRQVAPGETGVIADYNYKLPDDFTGCVIAWNTAKHDTGNYYYRSHRKTKLKPFERDLSSDDGNGVYTLSTYDFNPNVPVAYQATRVVVLSFELLNAPATVCGPKLSTELVKNQCVNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Ovary: bilateral
CB620809 1 Block

Frozen Tissue Blocks, Ovary: bilateral

Sign In for Pricing
View Details
Recombinant Ovine respiratory syncytial virus Non-structural protein 2 (1B)
MBS1351985-01 0.02 mg (E-Coli)

Recombinant Ovine respiratory syncytial virus Non-structural protein 2 (1B)

Sign In for Pricing
View Details
Recombinant Ovine respiratory syncytial virus Non-structural protein 2 (1B)
MBS1351985-02 0.1 mg (E-Coli)

Recombinant Ovine respiratory syncytial virus Non-structural protein 2 (1B)

Sign In for Pricing
View Details
Recombinant Ovine respiratory syncytial virus Non-structural protein 2 (1B)
MBS1351985-03 0.02 mg (Yeast)

Recombinant Ovine respiratory syncytial virus Non-structural protein 2 (1B)

Sign In for Pricing
View Details
Recombinant Ovine respiratory syncytial virus Non-structural protein 2 (1B)
MBS1351985-04 0.1 mg (Yeast)

Recombinant Ovine respiratory syncytial virus Non-structural protein 2 (1B)

Sign In for Pricing
View Details
Recombinant Ovine respiratory syncytial virus Non-structural protein 2 (1B)
MBS1351985-05 0.02 mg (Baculovirus)

Recombinant Ovine respiratory syncytial virus Non-structural protein 2 (1B)

Sign In for Pricing
View Details