Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Entry-fusion complex associated protein OPG095 (OPG099), partial

Recombinant Vaccinia virus Entry-fusion complex associated protein OPG095 (OPG099), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) ) . Target Name: VACWR088. Target Synonyms: Virion membrane protein M25. Accession Number: P07612. Expression Region: 2~183aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 23.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Vaccinia virus Entry-fusion complex associated protein OPG095 (OPG099), partial is a purified Recombinant Protein.

Accession Number

P07612

Expression Region

2~183aa

Host

Baculovirus

Target

VACWR088

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Virion membrane protein M25

Species

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Protein Name

Recombinant Protein

AA Sequence

GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FZD7 (Frizzled-7, Fz-7, hFz7, FzE3) (MaxLight 490)
MBS6200924-01 0.1 mL

FZD7 (Frizzled-7, Fz-7, hFz7, FzE3) (MaxLight 490)

Sign In for Pricing
View Details
FZD7 (Frizzled-7, Fz-7, hFz7, FzE3) (MaxLight 490)
MBS6200924-02 5x 0.1 mL

FZD7 (Frizzled-7, Fz-7, hFz7, FzE3) (MaxLight 490)

Sign In for Pricing
View Details
C13orf15 CRISPR Knock Out 293T Cell Line (Human)
53581141 1x 10^6 Cells / 1.0 mL

C13orf15 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
RED2 (ADARB2) Rabbit Polyclonal Antibody
TA343880 100 µL

RED2 (ADARB2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Bacillus subtilis PGA biosynthesis protein CapA (capA)
MBS1160727-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis PGA biosynthesis protein CapA (capA)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis PGA biosynthesis protein CapA (capA)
MBS1160727-02 0.02 mg (Yeast)

Recombinant Bacillus subtilis PGA biosynthesis protein CapA (capA)

Sign In for Pricing
View Details