Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Entry-fusion complex associated protein OPG095 (OPG099), partial

Recombinant Vaccinia virus Entry-fusion complex associated protein OPG095 (OPG099), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) ) . Target Name: VACWR088. Target Synonyms: Virion membrane protein M25. Accession Number: P07612. Expression Region: 2~183aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 23.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Vaccinia virus Entry-fusion complex associated protein OPG095 (OPG099), partial is a purified Recombinant Protein.

Accession Number

P07612

Expression Region

2~183aa

Host

Baculovirus

Target

VACWR088

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Virion membrane protein M25

Species

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Protein Name

Recombinant Protein

AA Sequence

GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CDC5L Antibody (PCRP-CDC5L-2C6) [DyLight 680]
NBP3-24018FR 0.1 mL

Mouse Monoclonal CDC5L Antibody (PCRP-CDC5L-2C6) [DyLight 680]

Sign In for Pricing
View Details
C14ORF37 antibody
70R-6640 50 ug

C14ORF37 antibody

Sign In for Pricing
View Details
Human Chitinase domain containing protein 1 (CHID1) ELISA Kit
MBS7250482-01 48 Well

Human Chitinase domain containing protein 1 (CHID1) ELISA Kit

Sign In for Pricing
View Details
Human Chitinase domain containing protein 1 (CHID1) ELISA Kit
MBS7250482-02 96 Well

Human Chitinase domain containing protein 1 (CHID1) ELISA Kit

Sign In for Pricing
View Details
Human Chitinase domain containing protein 1 (CHID1) ELISA Kit
MBS7250482-03 5x 96 Well

Human Chitinase domain containing protein 1 (CHID1) ELISA Kit

Sign In for Pricing
View Details
Human Chitinase domain containing protein 1 (CHID1) ELISA Kit
MBS7250482-04 10x 96 Well

Human Chitinase domain containing protein 1 (CHID1) ELISA Kit

Sign In for Pricing
View Details