Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Plasmodium falciparum Plasmepsin-2

Recombinant Plasmodium falciparum Plasmepsin-2 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Plasmodium falciparum. Target Name: Plasmodium falciparum Plasmepsin-2. Target Synonyms: Aspartic hemoglobinase II (PFAPD) . Accession Number: P46925. Expression Region: 125~453aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 40.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Plasmodium falciparum Plasmepsin-2 is a purified Recombinant Protein.

Accession Number

P46925

Expression Region

125~453aa

Host

Baculovirus

Target

Plasmodium falciparum Plasmepsin-2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aspartic hemoglobinase II (PFAPD)

Species

Plasmodium falciparum

Protein Name

Recombinant Protein

AA Sequence

SSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDGTKVEMNYVSGTVSGFFSKDLVTVGNLSLPYKFIEVIDTNGFEPTYTASTFDGILGLGWKDLSIGSVDPIVVELKNQNKIENALFTFYLPVHDKHTGFLTIGGIEERFYEGPLTYEKLNHDLYWQITLDAHVGNIMLEKANCIVDSGTSAITVPTDFLNKMLQNLDVIKVPFLPFYVTLCNNSKLPTFEFTSENGKYTLEPEYYLQHIEDVGPGLCMLNIIGLDFPVPTFILGDPFMRKYFTVFDYDNHSVGIALAKKNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uts2r (NM_020537) Rat Tagged Lenti ORF Clone
RR206552L3 10 µg

Uts2r (NM_020537) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Mcc shRNA (UAS) - Lentiviral mouse Mcc shRNA (UAS, RFP) plasmid
GTR15191665 1 Vial

Lentiviral mouse Mcc shRNA (UAS) - Lentiviral mouse Mcc shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Research Grade Anti-Human CD200R1/OX2R Antibody (23ME-00610)
HV213016-01 100 µg

Research Grade Anti-Human CD200R1/OX2R Antibody (23ME-00610)

Sign In for Pricing
View Details
Research Grade Anti-Human CD200R1/OX2R Antibody (23ME-00610)
HV213016-02 1 mg

Research Grade Anti-Human CD200R1/OX2R Antibody (23ME-00610)

Sign In for Pricing
View Details
Rabbit Monoclonal Mitochondria Antibody (MTC02/2860R) [DyLight 405]
NBP3-08548V 100 µL

Rabbit Monoclonal Mitochondria Antibody (MTC02/2860R) [DyLight 405]

Sign In for Pricing
View Details
PD1-PDL1 inhibitor 2
MBS578202 Inquire

PD1-PDL1 inhibitor 2

Sign In for Pricing
View Details