Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1

Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Tityus serrulatus (Brazilian scorpion) . Target Name: Tityus serrulatus Beta-mammal/insect toxin Ts1. Target Synonyms: PT-Mice-Ins-beta NaTx6.1 (Tityustoxin VII; Toxin II-11; Toxin III-10; Toxin T2-IV; Toxin gamma; TsTX-I) . Accession Number: P15226. Expression Region: 21~81aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 10.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1 is a purified Recombinant Protein.

Accession Number

P15226

Expression Region

21~81aa

Host

Baculovirus

Target

Tityus serrulatus Beta-mammal/insect toxin Ts1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PT-Mice-Ins-beta NaTx6.1 (Tityustoxin VII; Toxin II-11; Toxin III-10; Toxin T2-IV; Toxin gamma; TsTX-I)

Species

Tityus serrulatus (Brazilian scorpion)

Protein Name

Recombinant Protein

AA Sequence

KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
BNC680276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (PMEL/783), CF640R conjugate, 0.1mg/mL
BNC400783-500 1x 500 µL

Pmel17 / gp100 / SILV (PMEL/783), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (197-2B1), CF488A conjugate, 0.1mg/mL
BNC880931-100 1x 100 µL

CD46 (197-2B1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Topoisomerase I, MT (TOP1MT/488), CF740 conjugate, 0.1mg/mL
BNC740488-100 1x 100 µL

Topoisomerase I, MT (TOP1MT/488), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DQ) (SPV-L3), CF594 conjugate, 0.1mg/mL
BNC940200-100 1x 100 µL

MHC II (HLA-DQ) (SPV-L3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7/17 (C-46), CF740 conjugate, 0.1mg/mL
BNC740949-100 1x 100 µL

Cytokeratin 7/17 (C-46), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details