Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Enteropeptidase (Tmprss15), partial

Recombinant Mouse Enteropeptidase (Tmprss15), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Tmprss15. Target Synonyms: EnterokinaseSerine protease 7Transmembrane protease serine 15. Accession Number: P97435. Expression Region: 830~1069aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 32kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Enteropeptidase (Tmprss15), partial is a purified Recombinant Protein.

Accession Number

P97435

Expression Region

830~1069aa

Host

Mammalian Cells

Target

Tmprss15

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

EnterokinaseSerine protease 7Transmembrane protease serine 15

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SV2C Polyclonal Antibody
UB-GEN-12662 100 µL

SV2C Polyclonal Antibody

Sign In for Pricing
View Details
FXYD6 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-13234R-BF594 100 µL

FXYD6 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
IL-17 Antibody (biotin)
XP-5172Bt 0.05 mg

IL-17 Antibody (biotin)

Sign In for Pricing
View Details
Dectin-1 (C-type Lectin Domain Family 7 Member A, Dendritic Cell-associated C-type Lectin 1, DC-associated C-type Lectin 1, Beta-glucan Receptor, CANDF4, C-type Lectin Superfamily Member 12, CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082) (MaxLight 650)
D1876-48R-ML650 100 µL

Dectin-1 (C-type Lectin Domain Family 7 Member A, Dendritic Cell-associated C-type Lectin 1, DC-associated C-type Lectin 1, Beta-glucan Receptor, CANDF4, C-type Lectin Superfamily Member 12, CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082) (MaxLight 650)

Sign In for Pricing
View Details
ARL17P1, ID (ARL17A, ARL17P1, ADP-ribosylation factor-like protein 17, ADP-ribosylation factor 7 variant) (MaxLight 650)
MBS6275124-01 0.1 mL

ARL17P1, ID (ARL17A, ARL17P1, ADP-ribosylation factor-like protein 17, ADP-ribosylation factor 7 variant) (MaxLight 650)

Sign In for Pricing
View Details
ARL17P1, ID (ARL17A, ARL17P1, ADP-ribosylation factor-like protein 17, ADP-ribosylation factor 7 variant) (MaxLight 650)
MBS6275124-02 5x 0.1 mL

ARL17P1, ID (ARL17A, ARL17P1, ADP-ribosylation factor-like protein 17, ADP-ribosylation factor 7 variant) (MaxLight 650)

Sign In for Pricing
View Details