Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Enteropeptidase (Tmprss15), partial

Recombinant Mouse Enteropeptidase (Tmprss15), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Tmprss15. Target Synonyms: EnterokinaseSerine protease 7Transmembrane protease serine 15. Accession Number: P97435. Expression Region: 830~1069aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 32kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Enteropeptidase (Tmprss15), partial is a purified Recombinant Protein.

Accession Number

P97435

Expression Region

830~1069aa

Host

Mammalian Cells

Target

Tmprss15

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

EnterokinaseSerine protease 7Transmembrane protease serine 15

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP2K1 Rabbit Polyclonal Antibody
TA354832 100 µg

MAP2K1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IGFBP6 (Insulin Like Growth Factor Binding Protein 6) Rat ELISA Kit
E1891 96 Tests

IGFBP6 (Insulin Like Growth Factor Binding Protein 6) Rat ELISA Kit

Sign In for Pricing
View Details
Recombinant Rat Frataxin, mitochondrial (Fxn)
RPC20538-01 20 µg

Recombinant Rat Frataxin, mitochondrial (Fxn)

Sign In for Pricing
View Details
Recombinant Rat Frataxin, mitochondrial (Fxn)
RPC20538-02 100 µg

Recombinant Rat Frataxin, mitochondrial (Fxn)

Sign In for Pricing
View Details
Recombinant Rat Frataxin, mitochondrial (Fxn)
RPC20538-03 1 mg

Recombinant Rat Frataxin, mitochondrial (Fxn)

Sign In for Pricing
View Details
Human METTL23 (NM_001302703) AAV Particle
RC236424A1V 250 µL

Human METTL23 (NM_001302703) AAV Particle

Sign In for Pricing
View Details