Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse Prolactin (PRL)

Recombinant Horse Prolactin (PRL) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Horse (Equus caballus; Equine) . Target Name: PRL. Accession Number: P12420. Expression Region: 31~229aa. Tag Info: C-Terminal Hfc-Tagged. Theoretical MW: 51.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Horse Prolactin (PRL) is a purified Recombinant Protein.

Accession Number

P12420

Expression Region

31~229aa

Host

Mammalian Cells

Target

PRL

Conjugation

Unconjugated

Tag

C-Terminal Hfc-Tagged

Field of Research

Cell Proliferation

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Horse (Equus caballus; Equine)

Protein Name

Recombinant Protein

AA Sequence

LPICPSGAVNCQVSLRELFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFVTKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVSEVRGMQEAPEAILSKAIEIEEQNRRLLEGMEKIVGQVQPRIKENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse SAA2 -Serum Amyloid A2- CLIA Kit
E-CL-M0705-01 24 Tests

Mouse SAA2 -Serum Amyloid A2- CLIA Kit

Sign In for Pricing
View Details
Mouse SAA2 -Serum Amyloid A2- CLIA Kit
E-CL-M0705-02 48 Tests

Mouse SAA2 -Serum Amyloid A2- CLIA Kit

Sign In for Pricing
View Details
Mouse SAA2 -Serum Amyloid A2- CLIA Kit
E-CL-M0705-03 96 Tests

Mouse SAA2 -Serum Amyloid A2- CLIA Kit

Sign In for Pricing
View Details
Mouse SAA2 -Serum Amyloid A2- CLIA Kit
E-CL-M0705-04 5x 96 Tests

Mouse SAA2 -Serum Amyloid A2- CLIA Kit

Sign In for Pricing
View Details
Mouse SAA2 -Serum Amyloid A2- CLIA Kit
E-CL-M0705-05 10x 96 Tests

Mouse SAA2 -Serum Amyloid A2- CLIA Kit

Sign In for Pricing
View Details
TCF21 Antibody, mAb, Rabbit
A04354-100 100 µL

TCF21 Antibody, mAb, Rabbit

Sign In for Pricing
View Details