Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Complement factor I (Cfi)

Recombinant Mouse Complement factor I (Cfi) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Cfi. Target Synonyms: C3B/C4B inactivator. Accession Number: Q61129. Expression Region: 19~603aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 69.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Complement factor I (Cfi) is a purified Recombinant Protein.

Accession Number

Q61129

Expression Region

19~603aa

Host

Mammalian Cells

Target

Cfi

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

69.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

C3B/C4B inactivator

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

RSPSASDLPQEELVDQKCLLQKYTHRSCNKVFCQPWQRCIEGTCICKLPYQCPRAGTPVCAMNGRSYPTYCHQKSFECLHPEIKFSHNGTCAAEGKFNVSLIYGRTKTEGLVQVKLVDQDERMFICKNSWSMAEANVACVDLGFPLGVRDIQGSFNISGNLHINDTECLHVHCRGVETSLAECAFTKRRTELSNGLAGVVCYKQDADFPTSLSFQCVNGKHIPQEKACNGVNDCGDQSDELCCKGCRGNASLCKSGVCIPDQYKCNGEVDCITGEDESRCEEDRQQNIPKGLARSAQGEAEIETEETEMLTPGMDNERKRIKSLLPKLSCGVKRNTHTRRKRVIGGKPANVGDYPWQVAIKDGQRITCGGIYIGGCWILTAAHCVRPSRAHSYQVWTALLDWLKPNSQLGIQTVKRVIVHEKYNGATFQNDIALIEMKMHTGKKECELPNSVPACVPWSPYLFQPNDRCIISGWGRGKDNQKVYSLRWGEVDLIGNCSQFYPDRYYEKEMQCAGTRDGSIDACKGDSGGPLVCEDINNVTYVWGIVSWGENCGKPEFPGVYTRVANYFDWISYHVGRSLVSQHNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Digital Ultrasonic Cleaner
LX124UC 1 Unit

Digital Ultrasonic Cleaner

Sign In for Pricing
View Details
Mouse Cathepsin G (cath-G) ELISA Kit
MBS7239420-01 48 Well

Mouse Cathepsin G (cath-G) ELISA Kit

Sign In for Pricing
View Details
Mouse Cathepsin G (cath-G) ELISA Kit
MBS7239420-02 96 Well

Mouse Cathepsin G (cath-G) ELISA Kit

Sign In for Pricing
View Details
Mouse Cathepsin G (cath-G) ELISA Kit
MBS7239420-03 5x 96 Well

Mouse Cathepsin G (cath-G) ELISA Kit

Sign In for Pricing
View Details
Mouse Cathepsin G (cath-G) ELISA Kit
MBS7239420-04 10x 96 Well

Mouse Cathepsin G (cath-G) ELISA Kit

Sign In for Pricing
View Details
SHISA4 Protein Vector (Human) (pPM-C-His)
PV057736 500 ng

SHISA4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details