Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial

Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Asgr1. Target Synonyms: Hepatic lectin 1. Accession Number: P02706. Expression Region: 61~284aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial is a purified Recombinant Protein.

Accession Number

P02706

Expression Region

61~284aa

Host

Mammalian Cells

Target

Asgr1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hepatic lectin 1

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

QNSQLREDLRVLRQNFSNFTVSTEDQVKALTTQGERVGRKMKLVESQLEKHQEDLREDHSRLLLHVKQLVSDVRSLSCQMAALRGNGSERICCPINWVEYEGSCYWFSSSVKPWTEADKYCQLENAHLVVVTSWEEQRFVQQHMGPLNTWIGLTDQNGPWKWVDGTDYETGFKNWRPGQPDDWYGHGLGGGEDCAHFTTDGHWNDDVCRRPYRWVCETELGKAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP7 Antibody
A46058-50UG 50 µg

CASP7 Antibody

Sign In for Pricing
View Details
TranslationBlocker Human Interleukin-10/ IL-10 siRNA, 2nmol
QX36-2nmol 2nmol

TranslationBlocker Human Interleukin-10/ IL-10 siRNA, 2nmol

Sign In for Pricing
View Details
Human NGLY1 Pre-designed siRNA Set A
SI010521A 1 Each

Human NGLY1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
FastScan™ Total Rb ELISA Kit
CST 23595V2 10 Kits

FastScan™ Total Rb ELISA Kit

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Nucleocapsid Antibody-A5134, Human IgG1 (Trehalose free) (MALS verified)
NUN-M507-100ug 100 µg

Anti-SARS-CoV-2 Nucleocapsid Antibody-A5134, Human IgG1 (Trehalose free) (MALS verified)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Urease subunit alpha (ureC), partial
MBS1058463 Inquire

Recombinant Staphylococcus aureus Urease subunit alpha (ureC), partial

Sign In for Pricing
View Details