Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta

Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma) . Target Name: Calloselasma rhodostoma Snaclec rhodocytin subunit beta. Target Synonyms: Aggretin beta chain (Rhodoaggretin subunit beta) . Accession Number: Q9I840. Expression Region: 24~146aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 21.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta is a purified Recombinant Protein.

Accession Number

Q9I840

Expression Region

24~146aa

Host

E. coli

Target

Calloselasma rhodostoma Snaclec rhodocytin subunit beta

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aggretin beta chain (Rhodoaggretin subunit beta)

Species

Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)

Protein Name

Recombinant Protein

AA Sequence

DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human campylobacter jejuni antibody IgG (CJ-IgG) ELISA Kit
NSL2570Hu 96 Tests

Human campylobacter jejuni antibody IgG (CJ-IgG) ELISA Kit

Sign In for Pricing
View Details
Rat CC-chemokine receptor 3 (CCR3) Elisa Kit
EK720053 96 Well

Rat CC-chemokine receptor 3 (CCR3) Elisa Kit

Sign In for Pricing
View Details
LINS1 Rabbit pAb
E45R22029N-100 100 µL

LINS1 Rabbit pAb

Sign In for Pricing
View Details
TTFA, Mitochondrial Complex II inhibitor
TBI4565-500MG 500 mg

TTFA, Mitochondrial Complex II inhibitor

Sign In for Pricing
View Details
DEF8 Rabbit Polyclonal Antibody
TA332149 100 µL

DEF8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human CD163 Polyclonal Antibody
PHJ16301 100 μg

Anti-Human CD163 Polyclonal Antibody

Sign In for Pricing
View Details