Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Isoleucine--tRNA ligase, cytoplasmic (IARS), partial

Recombinant Human Isoleucine--tRNA ligase, cytoplasmic (IARS), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: IARS. Target Synonyms: Isoleucyl-tRNA synthetase; IRS; IleRS. Accession Number: P41252. Expression Region: 693~852aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 26.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Isoleucine--tRNA ligase, cytoplasmic (IARS), partial is a purified Recombinant Protein.

Accession Number

P41252

Expression Region

693~852aa

Host

E. coli

Target

IARS

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Isoleucyl-tRNA synthetase; IRS; IleRS

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DRWILSFMQSLIGFFETEMAAYRLYTVVPRLVKFVDILTNWYVRMNRRRLKGENGMEDCVMALETLFSVLLSLCRLMAPYTPFLTELMYQNLKVLIDPVSVQDKDTLSIHYLMLPRVREELIDKKTESAVSQMQSVIELGRVIRDRKTIPIKYPLKEIVV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coatomer subunit delta (ARCN1) CytoSection
TS410778P5 25 Slides

Coatomer subunit delta (ARCN1) CytoSection

Sign In for Pricing
View Details
Hsf5 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3589404 1.0 µg DNA

Hsf5 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Cat E-selectin, SELE ELISA KIT
E0094Cat-01 48 Well

Cat E-selectin, SELE ELISA KIT

Sign In for Pricing
View Details
Cat E-selectin, SELE ELISA KIT
E0094Cat-02 96 Well

Cat E-selectin, SELE ELISA KIT

Sign In for Pricing
View Details
Cat E-selectin, SELE ELISA KIT
E0094Cat-03 5x 96 Tests

Cat E-selectin, SELE ELISA KIT

Sign In for Pricing
View Details
Cat E-selectin, SELE ELISA KIT
E0094Cat-04 10x 96 Tests

Cat E-selectin, SELE ELISA KIT

Sign In for Pricing
View Details