Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Isoleucine--tRNA ligase, cytoplasmic (IARS), partial

Recombinant Human Isoleucine--tRNA ligase, cytoplasmic (IARS), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: IARS. Target Synonyms: Isoleucyl-tRNA synthetase; IRS; IleRS. Accession Number: P41252. Expression Region: 693~852aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 26.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Isoleucine--tRNA ligase, cytoplasmic (IARS), partial is a purified Recombinant Protein.

Accession Number

P41252

Expression Region

693~852aa

Host

E. coli

Target

IARS

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Isoleucyl-tRNA synthetase; IRS; IleRS

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DRWILSFMQSLIGFFETEMAAYRLYTVVPRLVKFVDILTNWYVRMNRRRLKGENGMEDCVMALETLFSVLLSLCRLMAPYTPFLTELMYQNLKVLIDPVSVQDKDTLSIHYLMLPRVREELIDKKTESAVSQMQSVIELGRVIRDRKTIPIKYPLKEIVV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Myb (phospho Ser532) Rabbit Polyclonal Antibody
APRab04477-01 20 µL

C-Myb (phospho Ser532) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C-Myb (phospho Ser532) Rabbit Polyclonal Antibody
APRab04477-02 50 µL

C-Myb (phospho Ser532) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C-Myb (phospho Ser532) Rabbit Polyclonal Antibody
APRab04477-03 100 µL

C-Myb (phospho Ser532) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C-Myb (phospho Ser532) Rabbit Polyclonal Antibody
APRab04477-04 200 µL

C-Myb (phospho Ser532) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Clnk (NM_013748) Mouse Tagged ORF Clone Lentiviral Particle
MR217254L4V 200 µL

Clnk (NM_013748) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CENP-A (Centromere Protein A) (APC)
C2615-APC 100 µL

CENP-A (Centromere Protein A) (APC)

Sign In for Pricing
View Details