Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Midkine (RIHB)

Recombinant Chicken Midkine (RIHB) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chicken (Gallus) . Target Name: RIHB. Target Synonyms: Retinoic acid-induced heparin-binding protein (RI-HB) . Accession Number: P24052. Expression Region: 22~142aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 20.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Chicken Midkine (RIHB) is a purified Recombinant Protein.

Accession Number

P24052

Expression Region

22~142aa

Host

E. coli

Target

RIHB

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Retinoic acid-induced heparin-binding protein (RI-HB)

Species

Chicken (Gallus)

Protein Name

Recombinant Protein

AA Sequence

AKAKKEKMKKEGSECQDWHWGPCIPNSKDCGLGYREGSCGDESRKLKCKIPCNWKKKFGADCKYKFESWGGCSAKTGVKTRSGILKKALYNAECEEVVYVSKPCTAKMKAKAKAKKGKGKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse C5a (Complement Component 5a) ELISA Kit
E-EL-M0339-01 24 Tests

Mouse C5a (Complement Component 5a) ELISA Kit

Sign In for Pricing
View Details
Mouse C5a (Complement Component 5a) ELISA Kit
E-EL-M0339-02 48 Tests

Mouse C5a (Complement Component 5a) ELISA Kit

Sign In for Pricing
View Details
Mouse C5a (Complement Component 5a) ELISA Kit
E-EL-M0339-03 96 Tests

Mouse C5a (Complement Component 5a) ELISA Kit

Sign In for Pricing
View Details
Recombinant Rat CD86/B7-2 Protein (His Tag)
PKSR030456-01 10 µg

Recombinant Rat CD86/B7-2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat CD86/B7-2 Protein (His Tag)
PKSR030456-02 50 µg

Recombinant Rat CD86/B7-2 Protein (His Tag)

Sign In for Pricing
View Details
Phospho-FAK (Y397) Recombinant Rabbit Monoclonal Antibody [SC54-07]
ET1610-34 100 µL

Phospho-FAK (Y397) Recombinant Rabbit Monoclonal Antibody [SC54-07]

Sign In for Pricing
View Details