Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Intercellular adhesion molecule 1 (ICAM1), partial

Recombinant Human Intercellular adhesion molecule 1 (ICAM1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ICAM1. Target Synonyms: Major group rhinovirus receptor; CD54. Accession Number: P05362. Expression Region: 28~480aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 76.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Intercellular adhesion molecule 1 (ICAM1), partial is a purified Recombinant Protein.

Accession Number

P05362

Expression Region

28~480aa

Host

E. coli

Target

ICAM1

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Cell Adhesion

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

76.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Major group rhinovirus receptor; CD54

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D- (+) -Trehalose dihydrate
GC7900-100g 100 g

D- (+) -Trehalose dihydrate

Sign In for Pricing
View Details
Frog, Human, Mouse, Rat CNTF Recombinant Protein (Animal Free) Lyophilized
MBS8431025-01 0.005 mg

Frog, Human, Mouse, Rat CNTF Recombinant Protein (Animal Free) Lyophilized

Sign In for Pricing
View Details
Frog, Human, Mouse, Rat CNTF Recombinant Protein (Animal Free) Lyophilized
MBS8431025-02 5x 0.005 mg

Frog, Human, Mouse, Rat CNTF Recombinant Protein (Animal Free) Lyophilized

Sign In for Pricing
View Details
BTF2 p44 Antibody / GTF2H2 / TFIIH
V9196-20UG 20 µg

BTF2 p44 Antibody / GTF2H2 / TFIIH

Sign In for Pricing
View Details
ACCα Rabbit Polyclonal Antibody
APRab06478-01 20 µL

ACCα Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACCα Rabbit Polyclonal Antibody
APRab06478-02 50 µL

ACCα Rabbit Polyclonal Antibody

Sign In for Pricing
View Details