Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Intercellular adhesion molecule 1 (ICAM1), partial

Recombinant Human Intercellular adhesion molecule 1 (ICAM1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ICAM1. Target Synonyms: Major group rhinovirus receptor; CD54. Accession Number: P05362. Expression Region: 28~480aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 76.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Intercellular adhesion molecule 1 (ICAM1), partial is a purified Recombinant Protein.

Accession Number

P05362

Expression Region

28~480aa

Host

E. coli

Target

ICAM1

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Cell Adhesion

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

76.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Major group rhinovirus receptor; CD54

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Uracil DNA Glycosylase ELISA Kit
MBS7255624-01 48 Well

Rat Uracil DNA Glycosylase ELISA Kit

Sign In for Pricing
View Details
Rat Uracil DNA Glycosylase ELISA Kit
MBS7255624-02 96 Well

Rat Uracil DNA Glycosylase ELISA Kit

Sign In for Pricing
View Details
Rat Uracil DNA Glycosylase ELISA Kit
MBS7255624-03 5x 96 Well

Rat Uracil DNA Glycosylase ELISA Kit

Sign In for Pricing
View Details
Rat Uracil DNA Glycosylase ELISA Kit
MBS7255624-04 10x 96 Well

Rat Uracil DNA Glycosylase ELISA Kit

Sign In for Pricing
View Details
LRRTM3 sgRNA CRISPR Lentivector set (Human)
K1239701 3x 1.0 µg

LRRTM3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Calmodulin (CAM)
MBS2119688-01 0.1 mL

APC-Linked Polyclonal Antibody to Calmodulin (CAM)

Sign In for Pricing
View Details