Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Crotalus atrox Phospholipase A2

Recombinant Crotalus atrox Phospholipase A2 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Crotalus atrox (Western diamondback rattlesnake) . Target Name: Crotalus atrox Phospholipase A2. Target Synonyms: Phosphatidylcholine 2-acylhydrolase. Accession Number: P0CV89. Expression Region: 1~61aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 11.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Crotalus atrox Phospholipase A2 is a purified Recombinant Protein.

Accession Number

P0CV89

Expression Region

1~61aa

Host

Baculovirus

Target

Crotalus atrox Phospholipase A2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

11.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Phosphatidylcholine 2-acylhydrolase

Species

Crotalus atrox (Western diamondback rattlesnake)

Protein Name

Recombinant Protein

AA Sequence

NLLQFNKMIKIMTKKNAFPFYTSYGCYCGWGGRCCFVHDCCYEKTDIYSYSWKRQICECDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Macrophage Cell Line-Ana-1-Luc-Puro
CC9F89 1x 10^6 Cells/Vial

Mouse Macrophage Cell Line-Ana-1-Luc-Puro

Sign In for Pricing
View Details
TTC22 CRISPR Activation Plasmid (m)
sc-432945-ACT 20 µg

TTC22 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein ywhD (ywhD)
MBS1192871-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis Uncharacterized protein ywhD (ywhD)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein ywhD (ywhD)
MBS1192871-02 0.1 mg (E-Coli)

Recombinant Bacillus subtilis Uncharacterized protein ywhD (ywhD)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein ywhD (ywhD)
MBS1192871-03 0.02 mg (Yeast)

Recombinant Bacillus subtilis Uncharacterized protein ywhD (ywhD)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein ywhD (ywhD)
MBS1192871-04 0.1 mg (Yeast)

Recombinant Bacillus subtilis Uncharacterized protein ywhD (ywhD)

Sign In for Pricing
View Details