Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trypsin-1 (PRSS1)

Recombinant Human Trypsin-1 (PRSS1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PRSS1. Target Synonyms: Beta-trypsin (Cationic trypsinogen; Serine protease 1; Trypsin I; TRP1; TRY1; TRYP1) . Accession Number: P07477. Expression Region: 24~247aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Trypsin-1 (PRSS1) is a purified Recombinant Protein.

Accession Number

P07477

Expression Region

24~247aa

Host

E. coli

Target

PRSS1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Beta-trypsin (Cationic trypsinogen; Serine protease 1; Trypsin I; TRP1; TRY1; TRYP1)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli Cardiolipin synthase (cls)
MBS7011687-01 0.02 mg

Recombinant Escherichia coli Cardiolipin synthase (cls)

Sign In for Pricing
View Details
Recombinant Escherichia coli Cardiolipin synthase (cls)
MBS7011687-02 0.1 mg

Recombinant Escherichia coli Cardiolipin synthase (cls)

Sign In for Pricing
View Details
Recombinant Escherichia coli Cardiolipin synthase (cls)
MBS7011687-03 5x 0.1 mg

Recombinant Escherichia coli Cardiolipin synthase (cls)

Sign In for Pricing
View Details
Human Reticulon 4 (RTN4) Protein
abx654948-01 10 µg

Human Reticulon 4 (RTN4) Protein

Sign In for Pricing
View Details
Human Reticulon 4 (RTN4) Protein
abx654948-02 50 µg

Human Reticulon 4 (RTN4) Protein

Sign In for Pricing
View Details
Human Reticulon 4 (RTN4) Protein
abx654948-03 100 µg

Human Reticulon 4 (RTN4) Protein

Sign In for Pricing
View Details