Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trypsin-1 (PRSS1)

Recombinant Human Trypsin-1 (PRSS1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PRSS1. Target Synonyms: Beta-trypsin (Cationic trypsinogen; Serine protease 1; Trypsin I; TRP1; TRY1; TRYP1) . Accession Number: P07477. Expression Region: 24~247aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Trypsin-1 (PRSS1) is a purified Recombinant Protein.

Accession Number

P07477

Expression Region

24~247aa

Host

E. coli

Target

PRSS1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Beta-trypsin (Cationic trypsinogen; Serine protease 1; Trypsin I; TRP1; TRY1; TRYP1)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRKL, 1-303aa, Human, His tag, E.coli
E53A01714 50 µg

CRKL, 1-303aa, Human, His tag, E.coli

Sign In for Pricing
View Details
NSUN3 CRISPR Activation Plasmid (h)
sc-408533-ACT 20 µg

NSUN3 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
TMIE CRISPR Activation Plasmid (m)
sc-423149-ACT 20 µg

TMIE CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Rabbit Polyclonal Respiratory Syncytial Virus A2 Antibody [DyLight 488]
NB100-93588G 0.1 mL

Rabbit Polyclonal Respiratory Syncytial Virus A2 Antibody [DyLight 488]

Sign In for Pricing
View Details
BCAR3 (NM_003567) Human Recombinant Protein
TP307930M 100 µg

BCAR3 (NM_003567) Human Recombinant Protein

Sign In for Pricing
View Details
KLC3 sgRNA CRISPR Lentivector (Human) (Target 1)
K1152902 1.0 µg DNA

KLC3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details