Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fibroblast growth factor 20 (Fgf20)

Recombinant Mouse Fibroblast growth factor 20 (Fgf20) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Fgf20. Target Synonyms: FGF-20. Accession Number: Q9ESL9. Expression Region: 1~211aa. Tag Info: Tag-Free. Theoretical MW: 23.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Fibroblast growth factor 20 (Fgf20) is a purified Recombinant Protein.

Accession Number

Q9ESL9

Expression Region

1~211aa

Host

E. coli

Target

Fgf20

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FGF-20

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Duck IgG (H&L) - AMCA
BS21275-01 100 µL

Mouse Anti-Duck IgG (H&L) - AMCA

Sign In for Pricing
View Details
Mouse Anti-Duck IgG (H&L) - AMCA
BS21275-02 500 µL

Mouse Anti-Duck IgG (H&L) - AMCA

Sign In for Pricing
View Details
MIPP (HIPER1, Inositol (1, inositol (1, 3, 4, 5) -tetrakisphosphate 3-Phosphatase, Ins (1, ins (1, 3, 4, 5) P (4) 3-Phosphatase, MINP1, Minpp1, MINPP2, MIPP, Multiple inositol polyphosphate histidine Phosphatase, 1, Multiple inositol polyphosphate Phosphatase 1, multiple inositol polyphosphate Phosphatase 2) discontinued
224190-01 50 µL

MIPP (HIPER1, Inositol (1, inositol (1, 3, 4, 5) -tetrakisphosphate 3-Phosphatase, Ins (1, ins (1, 3, 4, 5) P (4) 3-Phosphatase, MINP1, Minpp1, MINPP2, MIPP, Multiple inositol polyphosphate histidine Phosphatase, 1, Multiple inositol polyphosphate Phosphatase 1, multiple inositol polyphosphate Phosphatase 2) discontinued

Sign In for Pricing
View Details
MIPP (HIPER1, Inositol (1, inositol (1, 3, 4, 5) -tetrakisphosphate 3-Phosphatase, Ins (1, ins (1, 3, 4, 5) P (4) 3-Phosphatase, MINP1, Minpp1, MINPP2, MIPP, Multiple inositol polyphosphate histidine Phosphatase, 1, Multiple inositol polyphosphate Phosphatase 1, multiple inositol polyphosphate Phosphatase 2) discontinued
224190-02 100 µL

MIPP (HIPER1, Inositol (1, inositol (1, 3, 4, 5) -tetrakisphosphate 3-Phosphatase, Ins (1, ins (1, 3, 4, 5) P (4) 3-Phosphatase, MINP1, Minpp1, MINPP2, MIPP, Multiple inositol polyphosphate histidine Phosphatase, 1, Multiple inositol polyphosphate Phosphatase 1, multiple inositol polyphosphate Phosphatase 2) discontinued

Sign In for Pricing
View Details
MAGEA11 Rabbit Polyclonal Antibody (BF350)
orb2397493 100 µL

MAGEA11 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Rabbit Polyclonal GDPD3 Antibody [mFluor Violet 610 SE]
NBP2-97884MFV610 0.1 mL

Rabbit Polyclonal GDPD3 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details