Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cathepsin W (Ctsw)

Recombinant Mouse Cathepsin W (Ctsw) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Ctsw. Target Synonyms: CtswCathepsin W; EC 3.4.22.-; Lymphopain. Accession Number: P56203. Expression Region: 126~371aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 35.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Cathepsin W (Ctsw) is a purified Recombinant Protein.

Accession Number

P56203

Expression Region

126~371aa

Host

E. coli

Target

Ctsw

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CtswCathepsin W; EC 3.4.22.-; Lymphopain

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

VPRTCDWRKAKNIISSVKNQGSCKCCWAMAAADNIQALWRIKHQQFVDVSVQELLDCERCGNGCNGGFVWDAYLTVLNNSGLASEKDYPFQGDRKPHRCLAKKYKKVAWIQDFTMLSNNEQAIAHYLAVHGPITVTINMKLLQHYQKGVIKATPSSCDPRQVDHSVLLVGFGKEKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRLYRGNNTCGVTKYPFTAQVDSPVKKARTSCPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR1C4 Antibody - N-terminal region
MBS3224283-01 0.1 mL

AKR1C4 Antibody - N-terminal region

Sign In for Pricing
View Details
AKR1C4 Antibody - N-terminal region
MBS3224283-02 5x 0.1 mL

AKR1C4 Antibody - N-terminal region

Sign In for Pricing
View Details
NR3B (HRP) discontinued
N5380-70-HRP 100 µL

NR3B (HRP) discontinued

Sign In for Pricing
View Details
Lentiviral human ZKSCAN4 sgRNA gene knockout kit - Lentiviral human ZKSCAN4 sgRNA gene knockout kit (25)
GTR15389262 1 Vial

Lentiviral human ZKSCAN4 sgRNA gene knockout kit - Lentiviral human ZKSCAN4 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Angiopoietin-Related Protein 3 (ANGPTL3) Antibody Pair
abx370495-01 5x 96 Tests

Angiopoietin-Related Protein 3 (ANGPTL3) Antibody Pair

Sign In for Pricing
View Details
Angiopoietin-Related Protein 3 (ANGPTL3) Antibody Pair
abx370495-02 10x 96 Tests

Angiopoietin-Related Protein 3 (ANGPTL3) Antibody Pair

Sign In for Pricing
View Details