Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse F-box only protein 32 (Fbxo32)

Recombinant Mouse F-box only protein 32 (Fbxo32) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Fbxo32. Target Synonyms: Atrogin-1 (Muscle atrophy F-box protein; MAFbx) . Accession Number: Q9CPU7. Expression Region: 1~355aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 48.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse F-box only protein 32 (Fbxo32) is a purified Recombinant Protein.

Accession Number

Q9CPU7

Expression Region

1~355aa

Host

E. coli

Target

Fbxo32

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

48.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Atrogin-1 (Muscle atrophy F-box protein; MAFbx)

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MPFLGQDWRSPGQSWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYSKENLFSSLNYDVAAKKRKKDIQNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNSIQISRPAFKGLTITDLPVCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKRLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-7081-5p miRNA Agomir
orb1917335-01 5 nmol

Mmu-miR-7081-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-7081-5p miRNA Agomir
orb1917335-02 10 nmol

Mmu-miR-7081-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-7081-5p miRNA Agomir
orb1917335-03 20 nmol

Mmu-miR-7081-5p miRNA Agomir

Sign In for Pricing
View Details
SLC27A1 Rabbit Polyclonal Antibody (BF405)
orb2551376 100 µL

SLC27A1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
PBX2 (G17, Pre-B Cell Leukemia Transcription Factor 2, Homeobox Protein PBX2, Protein G17) (Not for Export EU)
130920 100 µL

PBX2 (G17, Pre-B Cell Leukemia Transcription Factor 2, Homeobox Protein PBX2, Protein G17) (Not for Export EU)

Sign In for Pricing
View Details
Rabbit anti-Bacillus subtilis (strain 168) rph Polyclonal Antibody
MBS7153956 Inquire

Rabbit anti-Bacillus subtilis (strain 168) rph Polyclonal Antibody

Sign In for Pricing
View Details