Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Griffithsia sp. Griffithsin (X31S)

Recombinant Griffithsia sp. Griffithsin (X31S) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Griffithsia sp. (strain Q66D336) (Red alga) . Target Name: Griffithsia sp. Griffithsin (X31S) . Accession Number: P84801. Expression Region: 1~121aa (X31S) . Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 20.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Griffithsia sp. Griffithsin (X31S) is a purified Recombinant Protein.

Accession Number

P84801

Expression Region

1~121aa (X31S)

Host

E. coli

Target

Griffithsia sp. Griffithsin (X31S)

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Griffithsia sp. (strain Q66D336) (Red alga)

Protein Name

Recombinant Protein

AA Sequence

SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDSIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r103 Double Nickase Plasmid (m)
sc-437108-NIC 20 µg

Vmn1r103 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
CS044 Rabbit Polyclonal Antibody
MBS9514080-01 0.05 mL

CS044 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CS044 Rabbit Polyclonal Antibody
MBS9514080-02 0.1 mL

CS044 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CS044 Rabbit Polyclonal Antibody
MBS9514080-03 5x 0.1 mL

CS044 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rac-N-Desisopropyl-N-ethyl acebutolol
IR27557-01 5 mg

Rac-N-Desisopropyl-N-ethyl acebutolol

Sign In for Pricing
View Details
Rac-N-Desisopropyl-N-ethyl acebutolol
IR27557-02 10 mg

Rac-N-Desisopropyl-N-ethyl acebutolol

Sign In for Pricing
View Details