Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Griffithsia sp. Griffithsin (X31S)

Recombinant Griffithsia sp. Griffithsin (X31S) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Griffithsia sp. (strain Q66D336) (Red alga) . Target Name: Griffithsia sp. Griffithsin (X31S) . Accession Number: P84801. Expression Region: 1~121aa (X31S) . Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 20.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Griffithsia sp. Griffithsin (X31S) is a purified Recombinant Protein.

Accession Number

P84801

Expression Region

1~121aa (X31S)

Host

E. coli

Target

Griffithsia sp. Griffithsin (X31S)

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Griffithsia sp. (strain Q66D336) (Red alga)

Protein Name

Recombinant Protein

AA Sequence

SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDSIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Na(+)/H(+) Exchange Regulatory Cofactor NHE-RF2 (SLC9A3R2) ELISA Kit
MBS9929093 Inquire

Donkey Na(+)/H(+) Exchange Regulatory Cofactor NHE-RF2 (SLC9A3R2) ELISA Kit

Sign In for Pricing
View Details
Goat tight junction protein 1 (ZO1) ELISA Kit
EIA07108Go 1 Kit

Goat tight junction protein 1 (ZO1) ELISA Kit

Sign In for Pricing
View Details
MAVS Positive Control
MBS5400730-01 5 Applications

MAVS Positive Control

Sign In for Pricing
View Details
MAVS Positive Control
MBS5400730-02 5x 5 Applications

MAVS Positive Control

Sign In for Pricing
View Details
Elmo2 (NM_207705) Mouse Tagged ORF Clone Lentiviral Particle
MR220048L3V 200 µL

Elmo2 (NM_207705) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Canine Olfactory receptor 4K3 (OR4K3P) ELISA Kit
GTR10345515 96 Well

Canine Olfactory receptor 4K3 (OR4K3P) ELISA Kit

Sign In for Pricing
View Details