Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli O157:H7 Metalloprotease stcE (stcE), partial

Recombinant E. coli O157:H7 Metalloprotease stcE (stcE), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O157:H7. Target Name: stcE. Target Synonyms: MucinaseNeutral zinc metalloprotease StcESecreted protease of C1 esterase inhibitor from EHEC. Accession Number: O82882. Expression Region: 296~551aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli O157:H7 Metalloprotease stcE (stcE), partial is a purified Recombinant Protein.

Accession Number

O82882

Expression Region

296~551aa

Host

E. coli

Target

StcE

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MucinaseNeutral zinc metalloprotease StcESecreted protease of C1 esterase inhibitor from EHEC

Species

E. coli O157:H7

Protein Name

Recombinant Protein

AA Sequence

ELLLHTIDIGMLTTPRDRFDFAKDKEAHREYFQTIPVSRMIVNNYAPLHLKEVMLPTGELLTDMDPGNGGWHSGTMRQRIGKELVSHGIDNANYGLNSTAGLGENSHPYVVAQLAAHNSRGNYANGIQVHGGSGGGGIVTLDSTLGNEFSHEVGHNYGLGHYVDGFKGSVHRSAENNNSTWGWDGDKKRFIPNFYPSQTNEKSCLNNQCQEPFDGHKFGFDAMAGGSPFSAANRFTMYTPNSSAIIQRFFENKAVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FKBP5 Antibody
KC-12196-01 50 μL

FKBP5 Antibody

Sign In for Pricing
View Details
FKBP5 Antibody
KC-12196-02 100 µL

FKBP5 Antibody

Sign In for Pricing
View Details
FKBP5 Antibody
KC-12196-03 1 mL

FKBP5 Antibody

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (rKRT16/1714), CF488A conjugate, 0.1mg/mL
BNC882149-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (rKRT16/1714), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung: left lower lobe
CS700856 5x 5 µm

Tissue FFPE Sections, Lung: left lower lobe

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2115), 0.2mg/mL
BNUB2115-100 1x 100 µL

Cytokeratin 8 (KRT8) (KRT8/2115), 0.2mg/mL

Sign In for Pricing
View Details