Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli O157:H7 Metalloprotease stcE (stcE), partial

Recombinant E. coli O157:H7 Metalloprotease stcE (stcE), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O157:H7. Target Name: stcE. Target Synonyms: MucinaseNeutral zinc metalloprotease StcESecreted protease of C1 esterase inhibitor from EHEC. Accession Number: O82882. Expression Region: 296~551aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli O157:H7 Metalloprotease stcE (stcE), partial is a purified Recombinant Protein.

Accession Number

O82882

Expression Region

296~551aa

Host

E. coli

Target

StcE

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MucinaseNeutral zinc metalloprotease StcESecreted protease of C1 esterase inhibitor from EHEC

Species

E. coli O157:H7

Protein Name

Recombinant Protein

AA Sequence

ELLLHTIDIGMLTTPRDRFDFAKDKEAHREYFQTIPVSRMIVNNYAPLHLKEVMLPTGELLTDMDPGNGGWHSGTMRQRIGKELVSHGIDNANYGLNSTAGLGENSHPYVVAQLAAHNSRGNYANGIQVHGGSGGGGIVTLDSTLGNEFSHEVGHNYGLGHYVDGFKGSVHRSAENNNSTWGWDGDKKRFIPNFYPSQTNEKSCLNNQCQEPFDGHKFGFDAMAGGSPFSAANRFTMYTPNSSAIIQRFFENKAVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Custom Anti-Peptide antibodies (peptide synthesis up to 30-aa, conjugation, 2 rabbits, ELISA)
ABPEP-30 1

Custom Anti-Peptide antibodies (peptide synthesis up to 30-aa, conjugation, 2 rabbits, ELISA)

Sign In for Pricing
View Details
Tcea2 3'UTR Lenti-reporter-Luc Vector
46324086 1.0 µg

Tcea2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Penumbra Double Nickase Plasmid (m)
sc-433185-NIC 20 µg

Penumbra Double Nickase Plasmid (m)

Sign In for Pricing
View Details
IleS Antibody
orb832829 2 mg

IleS Antibody

Sign In for Pricing
View Details
Asparagine synthetase (ASNS) (NM_001673) Human Tagged Lenti ORF Clone
RC201297L4 10 µg

Asparagine synthetase (ASNS) (NM_001673) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
C5orf33/NADK2 Rabbit Polyclonal Antibody (Cy3)
orb2587953 100 µg

C5orf33/NADK2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details