Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli O157:H7 Metalloprotease stcE (stcE), partial

Recombinant E. coli O157:H7 Metalloprotease stcE (stcE), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O157:H7. Target Name: stcE. Target Synonyms: MucinaseNeutral zinc metalloprotease StcESecreted protease of C1 esterase inhibitor from EHEC. Accession Number: O82882. Expression Region: 296~551aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli O157:H7 Metalloprotease stcE (stcE), partial is a purified Recombinant Protein.

Accession Number

O82882

Expression Region

296~551aa

Host

E. coli

Target

StcE

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MucinaseNeutral zinc metalloprotease StcESecreted protease of C1 esterase inhibitor from EHEC

Species

E. coli O157:H7

Protein Name

Recombinant Protein

AA Sequence

ELLLHTIDIGMLTTPRDRFDFAKDKEAHREYFQTIPVSRMIVNNYAPLHLKEVMLPTGELLTDMDPGNGGWHSGTMRQRIGKELVSHGIDNANYGLNSTAGLGENSHPYVVAQLAAHNSRGNYANGIQVHGGSGGGGIVTLDSTLGNEFSHEVGHNYGLGHYVDGFKGSVHRSAENNNSTWGWDGDKKRFIPNFYPSQTNEKSCLNNQCQEPFDGHKFGFDAMAGGSPFSAANRFTMYTPNSSAIIQRFFENKAVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5, NTPDase 5, CD39 Antigen-like 4, ER-UDPase, Guanosine-diphosphatase ENTPD5, GDPase ENTPD5, Nucleoside Diphosphatase, Uridine-diphosphatase ENTPD5, UDPase ENTPD5, CD39L4, PCPH) (APC)
126352-APC 100 µL

ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5, NTPDase 5, CD39 Antigen-like 4, ER-UDPase, Guanosine-diphosphatase ENTPD5, GDPase ENTPD5, Nucleoside Diphosphatase, Uridine-diphosphatase ENTPD5, UDPase ENTPD5, CD39L4, PCPH) (APC)

Sign In for Pricing
View Details
Rat myelin Protein zero, p0 GENLISA ELISA
KLR2162 96 Well

Rat myelin Protein zero, p0 GENLISA ELISA

Sign In for Pricing
View Details
Human GAN Pre-designed siRNA Set A
SI006056A 1 Each

Human GAN Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Human CPSF6 Protein, N-His
orb2833006-01 20 µg

Recombinant Human CPSF6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CPSF6 Protein, N-His
orb2833006-02 50 µg

Recombinant Human CPSF6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CPSF6 Protein, N-His
orb2833006-03 100 µg

Recombinant Human CPSF6 Protein, N-His

Sign In for Pricing
View Details