Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Iron-sulfur cluster repair protein ytfE (ytfE), Active Protein

Recombinant E. coli Iron-sulfur cluster repair protein ytfE (ytfE), Active Protein is a purified Active Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: YTFE. Target Synonyms: Regulator of cell morphogenesis and NO signaling. Accession Number: P69506. Expression Region: 1~220aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 51.9 kD. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Iron-sulfur cluster repair protein ytfE (ytfE), Active Protein is a purified Active Recombinant Protein.

Accession Number

P69506

Expression Region

1~220aa

Host

E. coli

Target

YTFE

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Biologically Active

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.9 kd

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Regulator of cell morphogenesis and NO signaling

Species

E. coli (strain K12)

Protein Name

Active Recombinant Protein

AA Sequence

MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Asah3l (BC059819) Mouse Tagged Lenti ORF Clone
MR202750L4 10 µg

Asah3l (BC059819) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mrpl24 Mouse siRNA Oligo Duplex (Locus ID 67707)
SR405741 1 Kit

Mrpl24 Mouse siRNA Oligo Duplex (Locus ID 67707)

Sign In for Pricing
View Details
PIK3R6 3'UTR Luciferase Stable Cell Line
TU017970 1.0 mL

PIK3R6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
LOC100503125 3'UTR GFP Stable Cell Line
TU161716 1.0 mL

LOC100503125 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RPL36AP6-set siRNA/shRNA/RNAi Lentivector (Human)
41583091 4x 500 ng

RPL36AP6-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Olfr92 (NM_146456) Mouse Tagged Lenti ORF Clone
MR212685L3 10 µg

Olfr92 (NM_146456) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details