Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Reactive oxygen species modulator 1 (Romo1)

Recombinant Mouse Reactive oxygen species modulator 1 (Romo1) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Romo1. Target Synonyms: Protein MGR2 homolog (ROS modulator 1) . Accession Number: P60603. Expression Region: 1~79aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 11.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Reactive oxygen species modulator 1 (Romo1) is a purified CF Transmembrane Protein.

Accession Number

P60603

Expression Region

1~79aa

Host

E. coli

Target

Romo1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

11.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein MGR2 homolog (ROS modulator 1)

Species

Mouse (Mus musculus)

Protein Name

CF Transmembrane Protein

AA Sequence

MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heparan Sulfate 2-O-sulfotransferase 1, NT (HS2ST1, HS2ST, 2-O-sulfotransferase, 2OST, dJ604K5.2, FLJ11317, KIAA0448, MGC131986) (AP) discontinued
H1890-25N-AP 200 µL

Heparan Sulfate 2-O-sulfotransferase 1, NT (HS2ST1, HS2ST, 2-O-sulfotransferase, 2OST, dJ604K5.2, FLJ11317, KIAA0448, MGC131986) (AP) discontinued

Sign In for Pricing
View Details
Anti-p38 Rabbit Monoclonal Antibody
M00176-4-40μl 40 µL

Anti-p38 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Zinc Finger Protein GLI2 (GLI2) Antibody
abx432750 200 µL

Zinc Finger Protein GLI2 (GLI2) Antibody

Sign In for Pricing
View Details
DGDPαS, L pack
JBS-NU-1164L 5x 20 μL

DGDPαS, L pack

Sign In for Pricing
View Details
Lentiviral human PROK1 shRNA (UAS) - Lentiviral human PROK1 shRNA (UAS) (25)
GTR15321188 1 Vial

Lentiviral human PROK1 shRNA (UAS) - Lentiviral human PROK1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Apolipoprotein M (APOM) Antibody (FITC)
abx273633-01 200 µL

Apolipoprotein M (APOM) Antibody (FITC)

Sign In for Pricing
View Details