Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Reactive oxygen species modulator 1 (Romo1)

Recombinant Mouse Reactive oxygen species modulator 1 (Romo1) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Romo1. Target Synonyms: Protein MGR2 homolog (ROS modulator 1) . Accession Number: P60603. Expression Region: 1~79aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 11.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Reactive oxygen species modulator 1 (Romo1) is a purified CF Transmembrane Protein.

Accession Number

P60603

Expression Region

1~79aa

Host

E. coli

Target

Romo1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

11.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein MGR2 homolog (ROS modulator 1)

Species

Mouse (Mus musculus)

Protein Name

CF Transmembrane Protein

AA Sequence

MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal CD45 Antibody (EM-05) [Janelia Fluor 549]
NBP1-44763JF549 0.1 mL

Rat Monoclonal CD45 Antibody (EM-05) [Janelia Fluor 549]

Sign In for Pricing
View Details
Mouse Polyclonal SELI Antibody
H00085465-A01 0.05 mL

Mouse Polyclonal SELI Antibody

Sign In for Pricing
View Details
GPR26 CRISPR All-in-one AAV vector set (with saCas9)(Human)
22550151 3x 1.0 µg DNA

GPR26 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Phenol, saturated (pH4.5)
PC6920 100ml

Phenol, saturated (pH4.5)

Sign In for Pricing
View Details
Mouse Prestin, SLC26A5 ELISA Kit
MBS9340464-01 48 Well

Mouse Prestin, SLC26A5 ELISA Kit

Sign In for Pricing
View Details
Mouse Prestin, SLC26A5 ELISA Kit
MBS9340464-02 96 Well

Mouse Prestin, SLC26A5 ELISA Kit

Sign In for Pricing
View Details