Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (Bnip3)

Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (Bnip3) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Bnip3. Target Synonyms: Nip3. Accession Number: O55003. Expression Region: 1~187aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 23.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (Bnip3) is a purified CF Transmembrane Protein.

Accession Number

O55003

Expression Region

1~187aa

Host

E. coli

Target

Bnip3

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nip3

Species

Mouse (Mus musculus)

Protein Name

CF Transmembrane Protein

AA Sequence

MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ALDH9A1 Antibody
NBP2-99130-50ul 50 µL

Rabbit Polyclonal ALDH9A1 Antibody

Sign In for Pricing
View Details
Hspa1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3970106 1.0 µg DNA

Hspa1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Mouse Vascular endothelial growth factor A ELISA Kit
MBS2883433-01 48 Well

Mouse Vascular endothelial growth factor A ELISA Kit

Sign In for Pricing
View Details
Mouse Vascular endothelial growth factor A ELISA Kit
MBS2883433-02 96 Well

Mouse Vascular endothelial growth factor A ELISA Kit

Sign In for Pricing
View Details
Mouse Vascular endothelial growth factor A ELISA Kit
MBS2883433-03 5x 96 Well

Mouse Vascular endothelial growth factor A ELISA Kit

Sign In for Pricing
View Details
Mouse Vascular endothelial growth factor A ELISA Kit
MBS2883433-04 10x 96 Well

Mouse Vascular endothelial growth factor A ELISA Kit

Sign In for Pricing
View Details