Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial, Active Protein

Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial, Active Protein is a purified Active Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: KLRK1. Target Synonyms: Killer cell lectin-like receptor subfamily K member 1 (NK cell receptor D; NKG2-D-activating NK receptor; CD314) . Accession Number: P26718. Expression Region: 78~216aa. Tag Info: C-Terminal Hfc-Tagged. Theoretical MW: 43.6kDa. Buffer: Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4 Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial, Active Protein is a purified Active Recombinant Protein.

Accession Number

P26718

Expression Region

78~216aa

Host

Mammalian Cells

Target

KLRK1

Conjugation

Unconjugated

Tag

C-Terminal Hfc-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>90% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Format

Lyophilized powder

Buffer

Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

43.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Killer cell lectin-like receptor subfamily K member 1 (NK cell receptor D; NKG2-D-activating NK receptor; CD314)

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpr137c ORF Vector (Rat) (pORF)
22506016 1.0 µg DNA

Gpr137c ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
KCND1, NT (KCND1, Potassium voltage-gated channel subfamily D member 1, Voltage-gated potassium channel subunit Kv4.1) (MaxLight 650)
MBS6312354-01 0.1 mL

KCND1, NT (KCND1, Potassium voltage-gated channel subfamily D member 1, Voltage-gated potassium channel subunit Kv4.1) (MaxLight 650)

Sign In for Pricing
View Details
KCND1, NT (KCND1, Potassium voltage-gated channel subfamily D member 1, Voltage-gated potassium channel subunit Kv4.1) (MaxLight 650)
MBS6312354-02 5x 0.1 mL

KCND1, NT (KCND1, Potassium voltage-gated channel subfamily D member 1, Voltage-gated potassium channel subunit Kv4.1) (MaxLight 650)

Sign In for Pricing
View Details
BRAND Transferpette S multi-12 0.5-10ul adjust vol
PIP5240 1 Each

BRAND Transferpette S multi-12 0.5-10ul adjust vol

Sign In for Pricing
View Details
2-Diethylaminoethanethiol hydrochloride 96%
D20100 25 g

2-Diethylaminoethanethiol hydrochloride 96%

Sign In for Pricing
View Details
Recombinant Human LIM Kinase 1 Protein - (Dry Ice)
H00003984-Q01-25ug 25 µg

Recombinant Human LIM Kinase 1 Protein - (Dry Ice)

Sign In for Pricing
View Details