Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 26S proteasome non-ATPase regulatory subunit 14 (PSMD14)

Recombinant Human 26S proteasome non-ATPase regulatory subunit 14 (PSMD14) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PSMD14. Target Synonyms: 26S proteasome regulatory subunit RPN11 (26S proteasome-associated PAD1 homolog 1; POH1) . Accession Number: O00487. Expression Region: 1~310aa. Tag Info: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Tagged. Theoretical MW: 79.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human 26S proteasome non-ATPase regulatory subunit 14 (PSMD14) is a purified Recombinant Protein.

Accession Number

O00487

Expression Region

1~310aa

Host

Baculovirus

Target

PSMD14

Conjugation

Unconjugated

Tag

N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

79.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

26S proteasome regulatory subunit RPN11 (26S proteasome-associated PAD1 homolog 1; POH1)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0232 Recombinant Protein Antigen
NBP2-49339PEP 0.1 mL

KIAA0232 Recombinant Protein Antigen

Sign In for Pricing
View Details
Recombinant Haemophilus ducreyi Argininosuccinate lyase (argH)
MBS1301397-01 0.02 mg (E-Coli)

Recombinant Haemophilus ducreyi Argininosuccinate lyase (argH)

Sign In for Pricing
View Details
Recombinant Haemophilus ducreyi Argininosuccinate lyase (argH)
MBS1301397-02 0.02 mg (Yeast)

Recombinant Haemophilus ducreyi Argininosuccinate lyase (argH)

Sign In for Pricing
View Details
Recombinant Haemophilus ducreyi Argininosuccinate lyase (argH)
MBS1301397-03 0.1 mg (E-Coli)

Recombinant Haemophilus ducreyi Argininosuccinate lyase (argH)

Sign In for Pricing
View Details
Recombinant Haemophilus ducreyi Argininosuccinate lyase (argH)
MBS1301397-04 0.1 mg (Yeast)

Recombinant Haemophilus ducreyi Argininosuccinate lyase (argH)

Sign In for Pricing
View Details
Recombinant Haemophilus ducreyi Argininosuccinate lyase (argH)
MBS1301397-05 0.02 mg (Baculovirus)

Recombinant Haemophilus ducreyi Argininosuccinate lyase (argH)

Sign In for Pricing
View Details