Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 26S proteasome non-ATPase regulatory subunit 14 (PSMD14)

Recombinant Human 26S proteasome non-ATPase regulatory subunit 14 (PSMD14) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PSMD14. Target Synonyms: 26S proteasome regulatory subunit RPN11 (26S proteasome-associated PAD1 homolog 1; POH1) . Accession Number: O00487. Expression Region: 1~310aa. Tag Info: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Tagged. Theoretical MW: 79.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human 26S proteasome non-ATPase regulatory subunit 14 (PSMD14) is a purified Recombinant Protein.

Accession Number

O00487

Expression Region

1~310aa

Host

Baculovirus

Target

PSMD14

Conjugation

Unconjugated

Tag

N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

79.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

26S proteasome regulatory subunit RPN11 (26S proteasome-associated PAD1 homolog 1; POH1)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
BNC470679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-500 1x 500 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF640R conjugate, 0.1mg/mL
BNC402475-500 1x 500 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details